Find Product:

Amyloid Beta-Peptide (1-40) (human)
A1124-1
ApexBio 1 mg
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Hu-48T
DL Develop 48T
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Hu-96T
DL Develop 96T
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Mu-48T
DL Develop 48T
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Mu-96T
DL Develop 96T
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Ra-48T
DL Develop 48T
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.
Rat Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DLR-Ab1-40-Ra-96T
DL Develop 96T
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DL-Ab1-40-Hu-192
DLdevelop 1 kit of 192 tests
Description: An ELISA kit based on the competitive inhibition method for detection and quantification of Human Amyloid Beta Peptide 1-40 (Ab1-40)
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DL-Ab1-40-Hu-48
DLdevelop 1 kit of 48 tests
Description: An ELISA kit based on the competitive inhibition method for detection and quantification of Human Amyloid Beta Peptide 1-40 (Ab1-40)
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DL-Ab1-40-Hu-96
DLdevelop 1 kit of 96 tests
Description: An ELISA kit based on the competitive inhibition method for detection and quantification of Human Amyloid Beta Peptide 1-40 (Ab1-40)

Did not find what you were looking for? Send us request and we will contact with you!