Find Product:

Human beta-Amyloid 1-40 (full length) peptide
Alpha Diagnostics 100 ug
Human beta-Amyloid 1-40 (full length) peptide
Alpha Diagnostics 1000 ug
Rat beta-Amyloid 1-40 (full length) peptide
Alpha Diagnostics 1 mg
Human beta-Amyloid 1-42 (full length) peptide
Alpha Diagnostics 100 ug
Human beta-Amyloid 1-42 (full length) peptide
Alpha Diagnostics 1000 ug
Rat beta-Amyloid 1-42 (full length) peptide
Alpha Diagnostics 1 mg
Amyloid Beta-Peptide (1-40) (human)
ApexBio 1 mg
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DL Develop 48T
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.
Human Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DL Develop 96T
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.
Mouse Amyloid Beta Peptide 1-40 (Ab1-40) ELISA Kit
DL Develop 48T
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse Amyloid Beta Peptide 1-40 (Ab1-40) in samples from serum, plasma or other biological fluids.

Did not find what you were looking for? Send us request and we will contact with you!