Image of Anti-GTPase HRAS Antibody

Anti-GTPase HRAS Antibody

Supplier BosterBio · Catalog number: RP1099

Price

334.00 EUR

Size
100ug/vial
Description
  • Clonality: Polyclonal
  • Ig type: Rabbit IgG
  • Form: Lyophilized
  • Specificity: No cross reactivity with other proteins.
  • Reactivity: Reacts with: mouse, rat Predicted to work with: human
  • Application: WB,IHC-P
  • Notes: Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.
  • Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human GTPase HRAS (101-137aa KRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLAR SY), identical to the related mouse and rat sequences.
  • Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
  • Purification: Immunogen affinity purified.
  • ReconstitutionAdd 0.2ml of distilled water will yield a concentration of 500ug/ml.
  • Gene Name: HRAS
  • Protein Name: GTPase Hras
  • Gene Full Name: Harvey rat sarcoma viral oncogene homolog
  • Uniprot ID: P01112
  • Entrez GeneID: 3265
  • Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
  • Shipping Condition: Shipped with wet ice

* The price of the product is approximate, please contact us for price confirmation

Related Products:

anti-GTPase Hras
YF-PA12448
Abfrontier 50 ul
anti-GTPase Hras
YF-PA12449
Abfrontier 50 ug
anti-GTPase Hras
YF-PA12450
Abfrontier 50 ul
Mouse Hras/ GTPase HRas ELISA Kit
E0694Mo
Sunlong 1 Kit
Human GTPase HRas (HRAS) ELISA Kit
abx250748-96tests
Abbexa 96 tests

Do you have a question? Do you want to order?
Contact us.