Image of Anti-Hyaluronan synthase 1/HAS1 Antibody

Anti-Hyaluronan synthase 1/HAS1 Antibody

Supplier BosterBio · Catalog number: A04784-1

Price

334.00 EUR

Size
100ug/vial
Description
  • Clonality: Polyclonal
  • Ig type: Rabbit IgG
  • Form: Lyophilized
  • Specificity: No cross reactivity with other proteins.
  • Reactivity: Reacts with: human, mouse, rat
  • Application: WB,IHC-P,IHC-F,ICC/IF,FCM
  • Notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.
  • Immunogen: A synthetic peptide corresponding to a sequence of human Hyaluronan synthase 1/HAS1(NRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPA)
  • Contents: Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
  • Purification: Immunogen affinity purified.
  • ReconstitutionAdd 0.2ml of distilled water will yield a concentration of 500μg/ml.
  • Gene Name: HAS1
  • Protein Name: Hyaluronan synthase 1
  • Gene Full Name: hyaluronan synthase 1
  • Uniprot ID: Q92839
  • Entrez GeneID: 3036
  • Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
  • Shipping Condition: Shipped with wet ice

* The price of the product is approximate, please contact us for price confirmation

Related Products:

Human Hyaluronan Synthase 1 (HAS1) ELISA Kit
DLR-HAS1-Hu-48T
DL Develop 48T
Human Hyaluronan Synthase 1 (HAS1) ELISA Kit
DLR-HAS1-Hu-96T
DL Develop 96T
Anti-Thymidylate Synthase Antibody
A04320-1
BosterBio 100uL
Hyaluronan Synthase 3 (HAS3) Antibody
20-abx005075
Abbexa
  • 100 ul
  • 200 ul
  • 20 ul
  • 50 ul
Hyaluronan Synthase 2 (HAS2) Antibody (Biotin)
20-abx105544
Abbexa
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Do you have a question? Do you want to order?
Contact us.