Image of Anti-PPAR gamma/PPARG Antibody

Anti-PPAR gamma/PPARG Antibody

Supplier BosterBio · Catalog number: A00449-2

Price

294.00 EUR

Size
100ug/vial
Description
  • Clonality: Polyclonal
  • Ig type: Rabbit IgG
  • Form: Lyophilized
  • Specificity: No cross reactivity with other proteins.
  • Reactivity: Reacts with: human, mouse, rat
  • Application: WB,FCM
  • Notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
  • Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human PPAR gamma (207-248aa AIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYD), identical to the related mouse and rat sequences.
  • Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
  • Purification: Immunogen affinity purified.
  • ReconstitutionAdd 0.2ml of distilled water will yield a concentration of 500ug/ml.
  • Gene Name: PPARG
  • Protein Name: Peroxisome proliferator-activated receptor gamma
  • Gene Full Name: peroxisome proliferator activated receptor gamma
  • Uniprot ID: P37231
  • Entrez GeneID: 5468
  • Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
  • Shipping Condition: Shipped with wet ice

* The price of the product is approximate, please contact us for price confirmation

Related Products:

Anti-PPAR gamma/PPARG Antibody
PA1320
BosterBio 100ug/vial
Polyclonal PPARG / PPAR Gamma Antibody (Internal)
AMR09482G
Leading Biology 0.05mg
Human Peroxisome Proliferator Activated Receptor Gamma (PPARg) ELISA Kit
RD-PPARg-Hu-96Tests
Reddot Biotech 96 Tests
Mouse Peroxisome Proliferator Activated Receptor Gamma (PPARg) ELISA Kit
RD-PPARg-Mu-48Tests
Reddot Biotech 48 Tests
Anti-PPARG antibody
STJ25069
St John's Laboratory 100 µl

Do you have a question? Do you want to order?
Contact us.