Image of LYVE-1 Recombinant Protein

LYVE-1 Recombinant Protein

Supplier ProSci · Catalog number: 91-539

Price

595.25 EUR

Size
0.05 mg
Description
  • Tested Applications: N/A
  • Applications: This recombinant protein can be used for biological assays. For research use only.
  • Predicted Molecular Weight: 24.6 kD
  • Physical state: Lyophilized
  • Buffer: Lyophilized from a 0.2 um filtered solution of 20mM Tris-Citrate,1 50mM NaCl, pH 7.0. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
  • Concentration: N/A
  • NCBI official symbol: LYVE1
  • Accession #: Q9Y5Y7
  • Protein GI: N/A
  • NCBI gene ID#: 10894
  • NCBI official full name: lymphatic vessel endothelial hyaluronan receptor 1
  • NCBI organism: Homo sapiens
  • Peptide sequence: LVQGSLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEACRLLGLSLAGKDQVETALKASFETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIRKVPVSRQFAAYCYNSSDTWTNSCIPEIITTKDPIFNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAAGFGGVPTVDHHHHHH
  • SWISSPROT #: Q9Y5Y7
  • Background Reference 1: N/A
  • Background Reference 2: N/A
  • Background Reference 3: N/A
  • Background Reference 4: N/A
  • Background Reference 5: N/A
  • Source: Human Cells
  • Species: Human
  • By Source: Human Cells
  • By Species: Human
  • Fusion tag: C-6 His tag
  • Sequence: Leu20-Thr238
  • Biology activity: N/A
  • Purity: Greater than 95% as determined by reducing SDS-PAGE.
    Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures. Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at -20°C for 3 months.

* The price of the product is approximate, please contact us for price confirmation

Related Products:

LYVE-1
RA25047
Neuromics 100 ul
Human CellExp? LYVE-1, mouse recombinant
P1017-10
Biovision
Recombinant Rat SDF-1 Alpha (CXCL12) Protein
PROTQ9QZD1-1
BosterBio 10ug
RSPO1 R-Spondin-1 Mouse Recombinant Protein
PROTQ9Z132-1
BosterBio Regular: 10ug
DLK1 Human, Delta-Like 1 Human Recombinant Protein, HEK
PROTP80370-1
BosterBio Regular: 10ug

Do you have a question? Do you want to order?
Contact us.