Image of Protein FAM3C Recombinant Protein

Protein FAM3C Recombinant Protein

Supplier ProSci · Catalog number: 91-317

Price

651.30 EUR

Size
0.05 mg
Description
  • Tested Applications: N/A
  • Applications: This recombinant protein can be used for biological assays. For research use only.
  • Predicted Molecular Weight: 23.2 kD
  • Physical state: Lyophilized
  • Buffer: Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.2. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
  • Concentration: N/A
  • NCBI official symbol: FAM3C
  • Accession #: Q92520
  • Protein GI: N/A
  • NCBI gene ID#: 10447
  • NCBI official full name: family with sequence similarity 3 member C
  • NCBI organism: Homo sapiens
  • Peptide sequence: QVFEIKMDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQDVDHHHHHH
  • SWISSPROT #: Q92520
  • Background Reference 1: N/A
  • Background Reference 2: N/A
  • Background Reference 3: N/A
  • Background Reference 4: N/A
  • Background Reference 5: N/A
  • Source: Human Cells
  • Species: Human
  • By Source: Human Cells
  • By Species: Human
  • Fusion tag: C-6 His tag
  • Sequence: Gln25-Asp227
  • Biology activity: N/A
  • Purity: Greater than 95% as determined by reducing SDS-PAGE.
    Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures. Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at -20°C for 3 months.

* The price of the product is approximate, please contact us for price confirmation

Related Products:

FAM3C Recombinant Protein (Rat)
RP200639
ABM 100 ug
FAM3C Recombinant Protein (Mouse)
RP133379
ABM 100 ug
FAM3C Protein Vector (Human) (pPM-C-HA)
PV015379
ABM 500 ng
FAM3C Protein Vector (Human) (pPM-C-His)
PV015380
ABM 500 ng
FAM3C 3'UTR Luciferase Stable Cell Line
TU007221
ABM 1.0 ml

Do you have a question? Do you want to order?
Contact us.