Image of Protein CutA Recombinant Protein

Protein CutA Recombinant Protein

Supplier ProSci · Catalog number: 91-235

Price

821.40 EUR

Size
0.05 mg
Description
  • Tested Applications: N/A
  • Applications: This recombinant protein can be used for biological assays. For research use only.
  • Predicted Molecular Weight: 17.9 kD
  • Physical state: Lyophilized
  • Buffer: Lyophilized from a 0.2 um filtered solution of 20mM TrisHCl, 1mM DTT, pH 8.0. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
  • Concentration: N/A
  • NCBI official symbol: CUTA
  • Accession #: O60888
  • Protein GI: 119632232
  • NCBI gene ID#: 51596
  • NCBI official full name: cutA divalent cation tolerance homolog (E. coli)
  • NCBI organism: Homo sapiens
  • Peptide sequence: MPALLPVASRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLPLEHHHHHH
  • SWISSPROT #: O60888
  • Background Reference 1: N/A
  • Background Reference 2: N/A
  • Background Reference 3: N/A
  • Background Reference 4: N/A
  • Background Reference 5: N/A
  • Source: E. coli
  • Species: Human
  • By Source: E. Coli
  • By Species: Human
  • Fusion tag: C-6 His tag
  • Sequence: Met1-Pro156
  • Biology activity: N/A
  • Purity: Greater than 95% as determined by reducing SDS-PAGE.
    Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures. Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at -20°C for 3 months.

* The price of the product is approximate, please contact us for price confirmation

Related Products:

Protein CutA (CUTA) Protein
20-abx260588
Abbexa
  • 1 mg
  • 25 ug
  • 5 ug
Protein CutA (CUTA) Antibody
20-abx006908
Abbexa
  • 100 ul
  • 200 ul
  • 20 ul
  • 50 ul
Recombinant Shigella Dysenteriae cutA Protein (aa 1-112)
VAng-Lsx06805-1mgEcoli
Creative Biolabs 1 mg (E. coli)
Recombinant Shigella Dysenteriae cutA Protein (aa 1-112)
VAng-Lsx06805-500gEcoli
Creative Biolabs 500 µg (E. coli)
Recombinant Human CutA Divalent Cation Tolerance Homolog
7-04952
CHI Scientific 25µg

Do you have a question? Do you want to order?
Contact us.