* The price of the product is approximate, please contact us for price confirmation

Description
- Category: Purified Polyclonal Antibodies
- Research Area: Cytokines & Growth Factors
- Immunogen: SOCS1 antibody was raised using the middle region of SOCS1 corresponding to a region with amino acids RQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVA
- Host: Rabbit
- Specificity: SOCS1 antibody was raised against the middle region of SOCS1
- Cross Reactivity: Human
- Isotype: NA
- Clone: NA
- Method of Purification: Affinity purified
- Concentration: 1 mg/ml
- Form & Buffer: Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Applications: WB
- Usage Recommendations: WB: 1 ug/ml
- Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
- Shipping: Blue Ice
Related Products:
|
||||||
|
||||||
|
||||||
|
||||||
|