Image of SOCS1 antibody

SOCS1 antibody

Supplier Fitzgerald · Catalog number: 70R-5877

Price

467.00 EUR

Size
50 ug
Description
  • Category: Purified Polyclonal Antibodies
  • Research Area: Cytokines & Growth Factors
  • Immunogen: SOCS1 antibody was raised using the middle region of SOCS1 corresponding to a region with amino acids RQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVA
  • Host: Rabbit
  • Specificity: SOCS1 antibody was raised against the middle region of SOCS1
  • Cross Reactivity: Human
  • Isotype: NA
  • Clone: NA
  • Method of Purification: Affinity purified
  • Concentration: 1 mg/ml
  • Form & Buffer: Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  • Applications: WB
  • Usage Recommendations: WB: 1 ug/ml
SOCS1 is a member of the STAT inhibitor (SSI) family, and known as cytokine signaling suppressor (SOCS). Members of the SSI family are cytokine-induced negative regulators of cytokine signaling. SOCS1 functions downstream of cytokine receptors and is involved in the negative feedback loop to attenuate cytokine signaling. Knockout studies in mice suggest a role for this gene as a modulator of IFN-gamma action, which is required for normal postnatal growth and survival.
  • Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
  • Shipping: Blue Ice

* The price of the product is approximate, please contact us for price confirmation

Related Products:

Human Suppressors Of Cytokine Signaling 1 (SOCS1) ELISA Kit
DLR-SOCS1-Hu-48T
DL Develop 48T
Human Suppressors Of Cytokine Signaling 1 (SOCS1) ELISA Kit
DLR-SOCS1-Hu-96T
DL Develop 96T
Mouse Suppressors Of Cytokine Signaling 1 (SOCS1) ELISA Kit
DLR-SOCS1-Mu-48T
DL Develop 48T
SOCS1 Antibody, HRP conjugated
1-CSB-PA022388LB01HU
Cusabio
  • 100ug
  • 50ug
SOCS1 Antibody, FITC conjugated
1-CSB-PA022388LC01HU
Cusabio
  • 100ug
  • 50ug

Do you have a question? Do you want to order?
Contact us.