GLUT4 Blocking Peptide

Supplier: Gentaur

0.01 GBP
Catalog: 91-33R-5310 Stock:On request
Product Size: 100 ug

You may also be interested


A synthetic peptide for use as a blocking control in assays to test for specificity of SLC2A4 antibody, catalog no. 70R-6693



  • Storage: Store at -20°C long term. Avoid repeat freeze-thaw cycles.
  • Shipping InfoBlue Ice


  • Category: Blocking Peptides
  • Research Area: Cell Biology
  • Residues: LQFGYNIGVINAPQKVIEQSYNETWLGRQGPEGPSSIPPGTLTTLWALSV
  • Type: Synthetic
  • Form & Buffer: Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
  • Applications: WB, IHC

0 reviews for Fitzgerald

Add a review

Your email address will not be published.