Image of SARS-CoV-2 (COVID-19) NTD Recombinant Protein

SARS-CoV-2 (COVID-19) NTD Recombinant Protein

Supplier ProSci · Catalog number: 10-079

Price

684.50 EUR

Size
0.1 mg
Description
  • Tested Applications: E
  • Applications: ELISA
  • Predicted Molecular Weight: The predicted molecular mass is ~36 kDa.
  • Physical state: Liquid
  • Buffer: This recombinant protein is aseptically packaged and formulated in 0.01 M phosphate buffered saline (PBS) pH 7.2 - 7.4, 150 mM NaCl with no carrier protein, potassium, calcium or preservatives added._x000D__x000D_
  • Concentration: 0.5 mg/ml
  • NCBI official symbol: N/A
  • Accession #: QHD43416.1
  • Protein GI: N/A
  • NCBI gene ID#: 1791269090
  • NCBI official full name: surface glycoprotein
  • NCBI organism: Severe acute respiratory syndrome coronavirus 2
  • Peptide sequence: VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKS
  • SWISSPROT #: N/A
  • Background Reference 1: Zhou, P., Yang, X., Wang, X. et al. Nature 579, 270–273. 2020.
  • Background Reference 2: Wu, F., Zhao, S., Yu, B. et al. Nature 579, 265–269. 2020.
  • Background Reference 3: Wrapp D, Wang N, Corbett KS, et al. bioRxiv. 2020.
  • Background Reference 4: Walls AC, Park YJ, Tortorici MA, et al. Cell. 181(2):281-292.e6. 2020.
  • Background Reference 5: N/A
  • Source: HEK293 cells
  • Species: SARS-CoV-2
  • By Source: Human Cells
  • By Species: Other
  • Fusion tag: N/A
  • Sequence: VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKS
  • Biology activity: N/A
  • Purity: >95% by SDS Page
Optimal dilutions/concentrations should be determined by the end user. The information provided is a guideline for product use. This product is for research use only. This recombinant protein may be stored as received at 2-8°C for up to one month. For longer term storage, aseptically aliquot in working volumes without diluting and store at -80°C. Avoid Repeated Freeze Thaw Cycles.

* The price of the product is approximate, please contact us for price confirmation

Related Products:

SARS-CoV-2 (COVID-19) S1 Recombinant Protein NTD
11-198
ProSci 0.1 mg
SARS-CoV-2 (COVID-19) S Protein NTD Recombinant Protein
92-738
ProSci 0.05 mg
SARS-CoV-2 (COVID-19) ORF8 Recombinant Protein
20-192
ProSci 0.1 mg
SARS-CoV-2 (COVID-19) ORF6 Recombinant Protein
20-193
ProSci 0.1 mg
SARS-CoV-2 (COVID-19) NSP1 Recombinant Protein
92-764
ProSci 0.05 mg

Do you have a question? Do you want to order?
Contact us.