URL to share

Catalog-Num	Product Name	Quantity	Price	Supplier	Category
68186-14-1	Resin acids and Rosin acids Me esters	1g	----Eur	chemotra
B161	Moeller Decarboxylase Broth Base USE With the addition of appropriate L_amino acids it is used to differentiate bacteria on the basis of their ability to decarboxylate the amino acids.	Qty per Litre of Medium: 10,52	6-Eur	biomarkt
B161	Decarboxylase Broth Base, Moeller USE With the addition of appropriate L_amino acids it is used to differentiate bacteria on the basis of their ability to decarboxylate the amino acids.	Qty per Litre of Medium: 10,52	6-Eur	biomarkt
57318-84	Ginkgolic Acids [Anacardic Acids]	100mg	----Eur	Nacala
B161	Moeller Decarboxylase Broth Base USE : With the addition of appropriate L-amino acids it is used to differentiate bacteria on the basis of their ability to decarboxylate the amino acids.	5x500gm	495-Eur	biomarkt
B161	Decarboxylase Broth Base, Moeller USE : With the addition of appropriate L-amino acids it is used to differentiate bacteria on the basis of their ability to decarboxylate the amino acids.	5x500gm	495-Eur	biomarkt
29-723	SLC1A5 has a broad substrate specificity, a preference for zwitterionic amino acids, and a sodium-dependence. It accepts as substrates all neutral amino acids, including glutamine, asparagine, and bra	0.1 mg	496-Eur	Prosci	rat
SMC-420D	Pannexin-2 Antibody Monoclonal, Clone number: S121A-31 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 11-664 (all but first 10 amino acids, encompassing extracellular and cytoplasmic	100ug	279-Eur	Stressmarq
68308-19-0	Fatty acids, C6_19_branched, copper(2+) Fatty acids, C6_19_bran	1g	----Eur	chemotra
67762-38-3	Fatty Acids, Unsaturated, C16_C18 and Fatty Acids, Unsaturate	1g	----Eur	chemotra	rat
25-935	SLC36A2 is involved in a pH-dependent electrogenic neuronal transport and sequestration of small amino acids amino acids such as glycine, alanine and proline. SLC36A2 is inhibited by sarcosine.	0.05 mg	632-Eur	Prosci	rat
26-910	Imported proteins require a nuclear localization sequence (NLS) which generally consists of a short region of basic amino acids or 2 such regions spaced about 10 amino acids apart. Proteins involved i	0.05 mg	632-Eur	Prosci	Proteins
orb80618	Human 4-1BB Ligand protein TNFSF9 Human Recombinant fused to 37 amino acids His tag at N-terminus produced in E.coli is a single, non-glycosylated polypeptide chain containing 222 amino acids (71-254	5	154-Eur	Biorb	recombinant
orb80951	Human Bcl2 protein Bcl-2 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing amino acids 1-206. The wild type Bcl-2 is missing 12 amino acids from C-terminu	2	154-Eur	Biorb	recombinant
orb81318	Human Ras Homolog Enriched in Brain protein RHEB Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 197 amino acids (1-181 amino acids) and having a molecu	10	154-Eur	Biorb	recombinant
orb81594	Hepatitis Virus NS3 His tag protein The E.coli derived recombinant protein contains total of 268 amino acids having Mw of 27.9 kDa. The protein contains the HCV NS3 immunodominant regions, amino acids	20	228-Eur	Biorb	recombinant
orb80252	Human Adiponectin Globular His tag protein Acrp30 Human has total of 171 amino acids. N-terminal underlined amino acids are His-tag and the protease cleavage site (31AA-Underlined). The AA sequence of	2	154-Eur	Biorb	human
AS08 369	Antibody: Tlp18.3 | Thylakoid lumen 18.3 kDa protein, Immunogen: synthetic peptides amino acids 227-241 and amino acids 242-256 from Arabidopsis thaliana Tlp18.3 protein sequence (accession At1g54780)	200	337-Eur	Gentaur
orb81744	HTLV-1 gp46 protein The E.coli derived recombinant mosaic protein contains the gp46 immunodominant regions, 162-214 amino acids and 242-257 amino acids, Mw on SDA-PAGE is 39kDa. For research use only.	100	228-Eur	Biorb	recombinant
orb80091	Human Neurotrophin-4 protein Neurotrophin-4 Human Recombinant produced in E.coli is noncovalently linked homodimer, non-glycosylated polypeptide chain containing x 130 amino acids (81-210 amino acids)	2	154-Eur	Biorb	recombinant
0640128	FMOC-L-Amino acids Kit [20 Amino acids]	kit	797-Eur	Sisco Research
orb81745	HTLV-1 Mosaic protein The E.coli derived recombinant mosaic protein contains the gp21 and gp46 immunodominant regions, 374-400 amino acids and 190-207 amino acids, the MW is 42kDa. The protein is fuse	100	228-Eur	Biorb	recombinant
227221	PMM-Acids & Alkalis-VT7-RLL225 _ PMM-Acids & Alkalis-VT7-RLL225 AC Signs;Pack-RL;	15 m Pcs Per Pack	179-Eur	Brady
227041	PMM-Acids & Alkalis-VT5-RLL127 _ PMM-Acids & Alkalis-VT5-RLL127 AC Signs;Pack-RL;	33 m Pcs Per Pack	337-Eur	Brady
227102	PMM-Acids & Alkalis-VT6-RLL225 _ PMM-Acids & Alkalis-VT6-RLL225 AC Signs;Pack-RL;	15 m Pcs Per Pack	179-Eur	Brady
orb81685	Treponema pallidum TmpA (Partial) protein The E.coli derived 68kDa recombinant protein contains the Trp. Pallidum TmpA immunodominant regions, 23-41 amino acids and 288-325 amino acids. For research u	100	228-Eur	Biorb	recombinant
29-766	SLC38A4 is found predominantly in liver and transports both cationic and neutral amino acids. The transport of cationic amino acids by SLC38A4 is Na (+) and pH independent, while the transport of neut	0.1 mg	496-Eur	Prosci	cat
orb72037	VIP (28 amino acids) peptide This is VIP (28 amino acids) peptide. For research use only.	1 mg	178-Eur	Biorb
264090	Z-L-Amino acids Kit [20 Amino Acids]	kit	651-Eur	Sisco Research
0240297	BOC-L-Amino Acids Kit [20 Amino Acids]	kit	858-Eur	Sisco Research
67701-05-7	Coconut oil fatty acids Coconut fatty acids	1g	----Eur	chemotra
26-437	ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids.ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids (Leonard et al., 2000 [PubMed 10970790]).	0.05 mg	632-Eur	Prosci	rat
NU-802-5FM	Nucleic acids: EDA-ADP - 5-FAM	160	746-Eur	Jena Bio
NU-820-ROX	Nucleic acids: EDA-GTP - 6-ROX	160	746-Eur	Jena Bio
NU-808-JOE	Nucleic acids: EDA-ATP - 6-JOE	160	746-Eur	Jena Bio
NU-808-CY5	Nucleic acids: EDA-ATP - Cy5	40	209-Eur	Jena Bio
NU-808-CY3	Nucleic acids: EDA-ATP - Cy3	40	209-Eur	Jena Bio
NU-808-5FM	Nucleic acids: EDA-ATP - 5-FAM	160	746-Eur	Jena Bio
NU-820-5FM	Nucleic acids: EDA-GTP - 5-FAM	160	746-Eur	Jena Bio
NU-808-776	Nucleic acids: EDA-ATP - DY-776	40	746-Eur	Jena Bio
NU-808-6FM	Nucleic acids: EDA-ATP - 6-FAM	160	746-Eur	Jena Bio
NU-808-751	Nucleic acids: EDA-ATP - DY-751	40	746-Eur	Jena Bio
NU-808-ROX	Nucleic acids: EDA-ATP - 6-ROX	160	746-Eur	Jena Bio
NU-802-6FM	Nucleic acids: EDA-ADP - 6-FAM	160	746-Eur	Jena Bio
NU-820-751	Nucleic acids: EDA-GTP - DY-751	40	746-Eur	Jena Bio
NU-802-CY3	Nucleic acids: EDA-ADP - Cy3	160	746-Eur	Jena Bio
NU-802-751	Nucleic acids: EDA-ADP - DY-751	40	746-Eur	Jena Bio
NU-802-CY5	Nucleic acids: EDA-ADP - Cy5	160	746-Eur	Jena Bio
NU-802-JOE	Nucleic acids: EDA-ADP - 6-JOE	160	746-Eur	Jena Bio
NU-820-CY3	Nucleic acids: EDA-GTP - Cy3	160	746-Eur	Jena Bio
NU-820-776	Nucleic acids: EDA-GTP - DY-776	40	746-Eur	Jena Bio
NU-820-CY5	Nucleic acids: EDA-GTP - Cy5	160	746-Eur	Jena Bio
NU-820-JOE	Nucleic acids: EDA-GTP - 6-JOE	160	746-Eur	Jena Bio
NU-802-ROX	Nucleic acids: EDA-ADP - 6-ROX	160	746-Eur	Jena Bio
NU-802-776	Nucleic acids: EDA-ADP - DY-776	40	746-Eur	Jena Bio
NU-820-TAM	Nucleic acids: EDA-GTP - 5_6-TAMRA	40	209-Eur	Jena Bio
NU-820-TXR	Nucleic acids: EDA-GTP - Texas Red	160	746-Eur	Jena Bio
NU-521	Nucleic acids: GP2(Nic), pack	300Units	933-Eur	Jena Bio
NU-820-MNT	Nucleic acids: EDA-GTP - MANT	200	746-Eur	Jena Bio
NU-808-565	Nucleic acids: EDA-ATP - ATTO-565	30	209-Eur	Jena Bio
NU-820-MB2	Nucleic acids: EDA-GTP - ATTO-MB2	40	746-Eur	Jena Bio
NU-524	Nucleic acids: 2'Br-AP2(Nic), pack	300Units	933-Eur	Jena Bio
NU-827-5FM	Nucleic acids: EDA-m7GDP - 5-FAM	160	746-Eur	Jena Bio
NU-831-5FM	Nucleic acids: 5-Propargylamino-CTP - 5-FAM	30	209-Eur	Jena Bio
NU-519	Nucleic acids: UP2(Nic), pack	300Units	933-Eur	Jena Bio
NU-827-JOE	Nucleic acids: EDA-m7GDP - 6-JOE	160	746-Eur	Jena Bio
NU-827-CY5	Nucleic acids: EDA-m7GDP - Cy5	160	746-Eur	Jena Bio
NU-808-425	Nucleic acids: EDA-ATP - ATTO-425	120	746-Eur	Jena Bio
NU-808-390	Nucleic acids: EDA-ATP - ATTO-390	80	746-Eur	Jena Bio
NU-827-ROX	Nucleic acids: EDA-m7GDP - 6-ROX	160	746-Eur	Jena Bio
NU-827-776	Nucleic acids: EDA-m7GDP - DY-776	40	746-Eur	Jena Bio
NU-827-751	Nucleic acids: EDA-m7GDP - DY-751	40	746-Eur	Jena Bio
NU-827-6FM	Nucleic acids: EDA-m7GDP - 6-FAM	160	746-Eur	Jena Bio
NU-808-465	Nucleic acids: EDA-ATP - ATTO-465	120	746-Eur	Jena Bio
NU-808-488	Nucleic acids: EDA-ATP - ATTO-488	20	209-Eur	Jena Bio
NU-827-CY3	Nucleic acids: EDA-m7GDP - Cy3	160	746-Eur	Jena Bio
NU-514	Nucleic acids: AP3(Nic), pack	300Units	933-Eur	Jena Bio
NU-808-532	Nucleic acids: EDA-ATP - ATTO-532	20	209-Eur	Jena Bio
NU-808-550	Nucleic acids: EDA-ATP - ATTO-550	20	209-Eur	Jena Bio
NU-518	Nucleic acids: TP2(Nic), pack	300Units	933-Eur	Jena Bio
NU-520	Nucleic acids: CP2(Nic), pack	300Units	933-Eur	Jena Bio
NU-821-ROX	Nucleic acids: Aminoallyl-UTP - 6-ROX	120	746-Eur	Jena Bio
NU-821-6FM	Nucleic acids: Aminoallyl-UTP - 6-FAM	30	209-Eur	Jena Bio
NU-824-6FM	Nucleic acids: EDA-m7GTP - 6-FAM	160	746-Eur	Jena Bio
NU-802-740	Nucleic acids: EDA-ADP - ATTO-740	40	746-Eur	Jena Bio
NU-802-725	Nucleic acids: EDA-ADP - ATTO-725	40	746-Eur	Jena Bio
NU-802-700	Nucleic acids: EDA-ADP - ATTO-700	40	746-Eur	Jena Bio
NU-802-680	Nucleic acids: EDA-ADP - ATTO-680	40	746-Eur	Jena Bio
NU-802-665	Nucleic acids: EDA-ADP - ATTO-665	400	746-Eur	Jena Bio
NU-802-661Q	Nucleic acids: EDA-ADP - DYQ-661	40	746-Eur	Jena Bio
NU-824-751	Nucleic acids: EDA-m7GTP - DY-751	40	746-Eur	Jena Bio
NU-824-776	Nucleic acids: EDA-m7GTP - DY-776	40	746-Eur	Jena Bio
NU-802-MB2	Nucleic acids: EDA-ADP - ATTO-MB2	40	746-Eur	Jena Bio
NU-802-MNT	Nucleic acids: EDA-ADP - MANT	200	746-Eur	Jena Bio
NU-821-JOE	Nucleic acids: Aminoallyl-UTP - 6-JOE	120	746-Eur	Jena Bio
NU-824-5FM	Nucleic acids: EDA-m7GTP - 5-FAM	160	746-Eur	Jena Bio
NU-821-CY5	Nucleic acids: Aminoallyl-UTP - Cy5	60	209-Eur	Jena Bio
NU-821-CY3	Nucleic acids: Aminoallyl-UTP - Cy3	60	209-Eur	Jena Bio
NU-821-776	Nucleic acids: Aminoallyl-UTP - DY-776	10	209-Eur	Jena Bio
NU-821-751	Nucleic acids: Aminoallyl-UTP - DY-751	40	746-Eur	Jena Bio
40300048-2	Casamino acids	500 g	121-Eur	Bioworld Consulting
NU-802-TXR	Nucleic acids: EDA-ADP - Texas Red	160	746-Eur	Jena Bio
NU-802-TAM	Nucleic acids: EDA-ADP - 5_6-TAMRA	160	746-Eur	Jena Bio
40300048-1	Casamino acids	100 g	96-Eur	Bioworld Consulting
na	D_Amino acids D_Aminos	1g	----Eur	chemotra
NU-802-656	Nucleic acids: EDA-ADP - OYSTER-656	40	746-Eur	Jena Bio
NK-112	Nucleic acids: Z (AICAR) Kit	1Kit	194-Eur	Jena Bio
NK-113	Nucleic acids: Xanthosine Kit	1Kit	194-Eur	Jena Bio
NU-802-488	Nucleic acids: EDA-ADP - ATTO-488	20	209-Eur	Jena Bio
NU-802-465	Nucleic acids: EDA-ADP - ATTO-465	120	746-Eur	Jena Bio
NU-802-425	Nucleic acids: EDA-ADP - ATTO-425	120	746-Eur	Jena Bio
NU-802-390	Nucleic acids: EDA-ADP - ATTO-390	80	746-Eur	Jena Bio
NU-824-CY5	Nucleic acids: EDA-m7GTP - Cy5	160	746-Eur	Jena Bio
NU-824-JOE	Nucleic acids: EDA-m7GTP - 6-JOE	160	746-Eur	Jena Bio
NK-115	Nucleic acids: Inosine Kit	1Kit	194-Eur	Jena Bio
NU-824-ROX	Nucleic acids: EDA-m7GTP - 6-ROX	160	746-Eur	Jena Bio
NU-802-495	Nucleic acids: EDA-ADP - ATTO-495	80	746-Eur	Jena Bio
NU-802-532	Nucleic acids: EDA-ADP - ATTO-532	80	746-Eur	Jena Bio
213316-49-5	Boc_Amino Acids _	1g	----Eur	chemotra
NU-824-CY3	Nucleic acids: EDA-m7GTP - Cy3	160	746-Eur	Jena Bio
na	Amino acids chelate containing Fe, Zn, Mg, Ca, Cu, Mn	1g	----Eur	chemotra
NU-802-655	Nucleic acids: EDA-ADP - ATTO-655	40	746-Eur	Jena Bio
NU-802-633	Nucleic acids: EDA-ADP - ATTO-633	40	746-Eur	Jena Bio
NU-802-620	Nucleic acids: EDA-ADP - ATTO-620	40	746-Eur	Jena Bio
NU-802-594	Nucleic acids: EDA-ADP - ATTO-594	40	746-Eur	Jena Bio
NU-802-590	Nucleic acids: EDA-ADP - ATTO-590	30	209-Eur	Jena Bio
NU-802-565	Nucleic acids: EDA-ADP - ATTO-565	120	746-Eur	Jena Bio
NU-802-550	Nucleic acids: EDA-ADP - ATTO-550	80	746-Eur	Jena Bio
NU-821-5FM	Nucleic acids: Aminoallyl-UTP - 5-FAM	30	209-Eur	Jena Bio
NU-808-680	Nucleic acids: EDA-ATP - ATTO-680	40	746-Eur	Jena Bio
NU-820-665	Nucleic acids: EDA-GTP - ATTO-665	400	746-Eur	Jena Bio
NU-820-661Q	Nucleic acids: EDA-GTP - DYQ-661	40	746-Eur	Jena Bio
NU-820-660Q	Nucleic acids: EDA-GTP - DYQ-660	40	746-Eur	Jena Bio
NU-820-655	Nucleic acids: EDA-GTP - ATTO-655	40	746-Eur	Jena Bio
NU-820-633	Nucleic acids: EDA-GTP - ATTO-633	40	746-Eur	Jena Bio
NU-820-620	Nucleic acids: EDA-GTP - ATTO-620	40	746-Eur	Jena Bio
NU-820-594	Nucleic acids: EDA-GTP - ATTO-594	40	746-Eur	Jena Bio
NU-820-590	Nucleic acids: EDA-GTP - ATTO-590	120	746-Eur	Jena Bio
NU-820-680	Nucleic acids: EDA-GTP - ATTO-680	40	746-Eur	Jena Bio
NU-808-TXR	Nucleic acids: EDA-ATP - Texas Red	160	746-Eur	Jena Bio
NU-808-TAM	Nucleic acids: EDA-ATP - 5_6-TAMRA	80	209-Eur	Jena Bio
NU-808-700	Nucleic acids: EDA-ATP - ATTO-700	40	746-Eur	Jena Bio
NU-808-725	Nucleic acids: EDA-ATP - ATTO-725	40	746-Eur	Jena Bio
NU-808-740	Nucleic acids: EDA-ATP - ATTO-740	40	746-Eur	Jena Bio
NU-820-725	Nucleic acids: EDA-GTP - ATTO-725	40	746-Eur	Jena Bio
NU-808-MB2	Nucleic acids: EDA-ATP - ATTO-MB2	40	746-Eur	Jena Bio
NU-808-MNT	Nucleic acids: EDA-ATP - MANT	50	209-Eur	Jena Bio
NU-1706-CY5	Nucleic acids: pCp-CY5	20	128-Eur	Jena Bio
NU-820-700	Nucleic acids: EDA-GTP - ATTO-700	40	746-Eur	Jena Bio
NU-820-565	Nucleic acids: EDA-GTP - ATTO-565	120	746-Eur	Jena Bio
NU-820-550	Nucleic acids: EDA-GTP - ATTO-550	80	746-Eur	Jena Bio
S507	YNB, WO AMINO ACIDS	100G	112-Eur	BioBasic
NU-820-425	Nucleic acids: EDA-GTP - ATTO-425	120	746-Eur	Jena Bio
S507	YNB, WO AMINO ACIDS	500G	330-Eur	BioBasic
NU-820-390	Nucleic acids: EDA-GTP - ATTO-390	80	746-Eur	Jena Bio
014070	AMINO ACIDS KIT	1 kit	181-Eur	Sisco Research
K 0363	MEM amino acids (50x)	100 ml	44-Eur	Biochro
NU-909-5	Nucleic acids: EDA-AMP, 5 mg pack	5mg	316-Eur	Jena Bio
NU-909-1	Nucleic acids: EDA-AMP, 1 mg pack	1mg	128-Eur	Jena Bio
NU-820-465	Nucleic acids: EDA-GTP - ATTO-465	120	746-Eur	Jena Bio
NU-820-488	Nucleic acids: EDA-GTP - ATTO-488	80	746-Eur	Jena Bio
NU-802-660Q	Nucleic acids: EDA-ADP - DYQ-660	40	746-Eur	Jena Bio
NU-820-532	Nucleic acids: EDA-GTP - ATTO-532	80	746-Eur	Jena Bio
NU-820-495	Nucleic acids: EDA-GTP - ATTO-495	80	746-Eur	Jena Bio
NU-820-656	Nucleic acids: EDA-GTP - OYSTER-656	40	746-Eur	Jena Bio
NU-156-25	Nucleic acids: 8Br-AMP, 25 mg pack	25mg	118-Eur	Jena Bio
869	ORGANIC ACIDS, SERUM	1	163-Eur	Kenova
NU-156-5	Nucleic acids: 8Br-AMP, 5 mg pack	5mg	70-Eur	Jena Bio
PK-102	Nucleic acids: JBS Halo-GTP Kit	6nucleotides	321-Eur	Jena Bio
551	BILE ACIDS, SERUM	1	40-Eur	Kenova
0140263	L-AMINO ACIDS KIT	1 kit	197-Eur	Sisco Research
NU-808-620	Nucleic acids: EDA-ATP - ATTO-620	40	746-Eur	Jena Bio
NU-831-JOE	Nucleic acids: 5-Propargylamino-CTP - 6-JOE	120	746-Eur	Jena Bio
NU-523	Nucleic acids: 8Br-AP2(Nic), pack	300Units	933-Eur	Jena Bio
LNA-400	Locked Nucleic Acids (LNA)	400 nmole x10	63-Eur	British Biocelle
NU-831-ROX	Nucleic acids: 5-Propargylamino-CTP - 6-ROX	120	746-Eur	Jena Bio
NU-808-495	Nucleic acids: EDA-ATP - ATTO-495	80	746-Eur	Jena Bio
NU-808-655	Nucleic acids: EDA-ATP - ATTO-655	10	209-Eur	Jena Bio
PK-101	Nucleic acids: JBS Halo-ATP Kit	12nucleotides	489-Eur	Jena Bio
NU-820-740	Nucleic acids: EDA-GTP - ATTO-740	40	746-Eur	Jena Bio
NU-808-633	Nucleic acids: EDA-ATP - ATTO-633	10	209-Eur	Jena Bio
S507	YNB, WO AMINO ACIDS	100G	112-Eur	British Biocelle
K 0363	MEM amino acids (50x)	3 x 100 ml	69-Eur	Biochro
S507	YNB, WO AMINO ACIDS	500G	330-Eur	British Biocelle
NU-831-CY5	Nucleic acids: 5-Propargylamino-CTP - Cy5	30	209-Eur	Jena Bio
NU-831-CY3	Nucleic acids: 5-Propargylamino-CTP - Cy3	30	209-Eur	Jena Bio
NU-831-6FM	Nucleic acids: 5-Propargylamino-CTP - 6-FAM	30	209-Eur	Jena Bio
NU-808-661Q	Nucleic acids: EDA-ATP - DYQ-661	40	746-Eur	Jena Bio
NU-808-665	Nucleic acids: EDA-ATP - ATTO-665	400	746-Eur	Jena Bio
NU-831-751	Nucleic acids: 5-Propargylamino-CTP - DY-751	40	746-Eur	Jena Bio
NU-808-656	Nucleic acids: EDA-ATP - OYSTER-656	40	746-Eur	Jena Bio
NU-808-594	Nucleic acids: EDA-ATP - ATTO-594	40	746-Eur	Jena Bio
NU-808-590	Nucleic acids: EDA-ATP - ATTO-590	120	746-Eur	Jena Bio
NU-831-776	Nucleic acids: 5-Propargylamino-CTP - DY-776	40	746-Eur	Jena Bio
NU-808-660Q	Nucleic acids: EDA-ATP - DYQ-660	40	746-Eur	Jena Bio
NU-810-6FM	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - 6-FAM	120	746-Eur	Jena Bio
NU-831-700	Nucleic acids: 5-Propargylamino-CTP - ATTO-700	40	746-Eur	Jena Bio
NU-1127L	Nucleic acids: 2'OMe-GTP, L pack	750Units	316-Eur	Jena Bio
NU-824-390	Nucleic acids: EDA-m7GTP - ATTO-390	80	746-Eur	Jena Bio
NU-109S	Nucleic acids: 2'I-ADP, S pack	30Units	128-Eur	Jena Bio
NU-821-MB2	Nucleic acids: Aminoallyl-UTP - ATTO-MB2	40	746-Eur	Jena Bio
NU-821-MNT	Nucleic acids: Aminoallyl-UTP - MANT	100	746-Eur	Jena Bio
NU-821-TXR	Nucleic acids: Aminoallyl-UTP - Texas Red	120	746-Eur	Jena Bio
NU-821-TAM	Nucleic acids: Aminoallyl-UTP - 5_6-TAMRA	30	209-Eur	Jena Bio
NU-821-740	Nucleic acids: Aminoallyl-UTP - ATTO-740	40	746-Eur	Jena Bio
NU-821-661Q	Nucleic acids: Aminoallyl-UTP - DYQ-661	40	746-Eur	Jena Bio
NU-110L	Nucleic acids: 2'Br-ADP, L pack	150Units	316-Eur	Jena Bio
NU-101S	Nucleic acids: 2'I-ATP, S pack	30Units	133-Eur	Jena Bio
NU-810-JOE	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - 6-JOE	120	746-Eur	Jena Bio
NU-1116S	Nucleic acids: 8-Oxo-GTP, S pack	50Units	133-Eur	Jena Bio
NU-810-776	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - DY-776	40	746-Eur	Jena Bio
NU-1116L	Nucleic acids: 8-Oxo-GTP, L pack	250Units	331-Eur	Jena Bio
NU-810-CY3	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - Cy3	120	746-Eur	Jena Bio
NU-1115S	Nucleic acids: 5F-UTP, S pack	100Units	133-Eur	Jena Bio
NU-1115L	Nucleic acids: 5F-UTP, L pack	500Units	331-Eur	Jena Bio
NU-821-725	Nucleic acids: Aminoallyl-UTP - ATTO-725	40	746-Eur	Jena Bio
NU-810-CY5	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - Cy5	120	746-Eur	Jena Bio
NU-111L	Nucleic acids: 8I-ADP, L pack	250Units	316-Eur	Jena Bio
NU-111S	Nucleic acids: 8I-ADP, S pack	50Units	128-Eur	Jena Bio
NU-810-751	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - DY-751	40	746-Eur	Jena Bio
NU-821-DIGX	Nucleic acids: DIG-11-UTP, pack	50	190-Eur	Jena Bio
NU-1609-CY5	Nucleic acids: EDA-ATPgammaS - Cy5	50	1714-Eur	Jena Bio
NU-821-665	Nucleic acids: Aminoallyl-UTP - ATTO-665	400	746-Eur	Jena Bio
NU-821-680	Nucleic acids: Aminoallyl-UTP - ATTO-680	10	209-Eur	Jena Bio
NU-1127S	Nucleic acids: 2'OMe-GTP, S pack	150Units	128-Eur	Jena Bio
NU-110S	Nucleic acids: 2'Br-ADP, S pack	30Units	128-Eur	Jena Bio
NU-1609-JOE	Nucleic acids: EDA-ATPgammaS - 6-JOE	50	1714-Eur	Jena Bio
NU-1609-ROX	Nucleic acids: EDA-ATPgammaS - 6-ROX	50	1714-Eur	Jena Bio
NU-810-ROX	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - 6-ROX	120	746-Eur	Jena Bio
NU-821-700	Nucleic acids: Aminoallyl-UTP - ATTO-700	40	746-Eur	Jena Bio
FP-21024	Nucleic acids: pGLOW-TXN-Bs2	1Plasmid	556-Eur	Jena Bio
CSS-380	Organic acids or its substitutes: Taurine, 0.1 M	100ml	56-Eur	Jena Bio
NU-821-425	Nucleic acids: Aminoallyl-UTP - ATTO-425	80	746-Eur	Jena Bio
NU-821-465	Nucleic acids: Aminoallyl-UTP - ATTO-465	80	746-Eur	Jena Bio
NU-821-488	Nucleic acids: Aminoallyl-UTP - ATTO-488	20	209-Eur	Jena Bio
NU-821-495	Nucleic acids: Aminoallyl-UTP - ATTO-495	800	746-Eur	Jena Bio
CSS-189	Amino acids or its derivatives: Glycine, 1 M	100ml	61-Eur	Jena Bio
NU-821-5	Nucleic acids: Aminoallyl-UTP, 5 mg pack	5mg	411-Eur	Jena Bio
CSS-089	Amino acids or its derivatives: Glycine pH 9.5, 1 M	100ml	66-Eur	Jena Bio
NU-821-390	Nucleic acids: Aminoallyl-UTP - ATTO-390	80	746-Eur	Jena Bio
NU-821-1	Nucleic acids: Aminoallyl-UTP, 1 mg pack	1mg	116-Eur	Jena Bio
NU-820-BIO	Nucleic acids: EDA-GTP - Biotin, pack	50	172-Eur	Jena Bio
FP-21025	Nucleic acids: pGLOW-TXN-Pp1	1Plasmid	556-Eur	Jena Bio
FP-21026	Nucleic acids: pGLOW-KXN-Bs1	1Plasmid	556-Eur	Jena Bio
FP-21023	Nucleic acids: pGLOW-TXN-Bs1	1Plasmid	556-Eur	Jena Bio
FP-21027	Nucleic acids: pGLOW-KXN-Bs2	1Plasmid	556-Eur	Jena Bio
NU-820L	Nucleic acids: EDA-GTP, L pack	150Units	316-Eur	Jena Bio
NU-113L	Nucleic acids: 8I-ATP, L pack	250Units	316-Eur	Jena Bio
FP-21028	Nucleic acids: pGLOW-KXN-Pp1	1Plasmid	556-Eur	Jena Bio
NU-820S	Nucleic acids: EDA-GTP, S pack	30Units	128-Eur	Jena Bio
NU-821-532	Nucleic acids: Aminoallyl-UTP - ATTO-532	80	746-Eur	Jena Bio
NU-114L	Nucleic acids: 8Br-ATP, L pack	500Units	316-Eur	Jena Bio
FP-21064	Nucleic acids: pGlow-C-Pp1	1Plasmid	556-Eur	Jena Bio
NU-113S	Nucleic acids: 8I-ATP, S pack	50Units	128-Eur	Jena Bio
NU-112L	Nucleic acids: 8Br-ADP, L pack	500Units	316-Eur	Jena Bio
NU-833-ROX	Nucleic acids: gamma-[6-Aminohexyl]-ATP - 6-ROX	160	746-Eur	Jena Bio
NU-821-656	Nucleic acids: Aminoallyl-UTP - OYSTER-656	40	746-Eur	Jena Bio
NU-821-660Q	Nucleic acids: Aminoallyl-UTP - DYQ-660	40	746-Eur	Jena Bio
NU-1609-776	Nucleic acids: EDA-ATPgammaS - DY-776	50	1714-Eur	Jena Bio
NU-1609-CY3	Nucleic acids: EDA-ATPgammaS - Cy3	50	1714-Eur	Jena Bio
FP-21063	Nucleic acids: pGlow-C-Bs2	1Plasmid	556-Eur	Jena Bio
NU-821-655	Nucleic acids: Aminoallyl-UTP - ATTO-655	140	746-Eur	Jena Bio
NU-821-633	Nucleic acids: Aminoallyl-UTP - ATTO-633	40	746-Eur	Jena Bio
NU-821-550	Nucleic acids: Aminoallyl-UTP - ATTO-550	80	746-Eur	Jena Bio
NU-821-565	Nucleic acids: Aminoallyl-UTP - ATTO-565	80	746-Eur	Jena Bio
NU-821-590	Nucleic acids: Aminoallyl-UTP - ATTO-590	80	746-Eur	Jena Bio
CLK-NU-001-5	Nucleic acids: N6-Propargyl-ATP, L pack	5mg	389-Eur	Jena Bio
CLK-NU-001-1	Nucleic acids: N6-Propargyl-ATP, S pack	1mg	120-Eur	Jena Bio
NU-821-594	Nucleic acids: Aminoallyl-UTP - ATTO-594	40	746-Eur	Jena Bio
NU-114S	Nucleic acids: 8Br-ATP, S pack	100Units	128-Eur	Jena Bio
NU-821-620	Nucleic acids: Aminoallyl-UTP - ATTO-620	40	746-Eur	Jena Bio
NU-112S	Nucleic acids: 8Br-ADP, S pack	100Units	128-Eur	Jena Bio
NU-833-CY5	Nucleic acids: gamma-[6-Aminohexyl]-ATP - Cy5	160	746-Eur	Jena Bio
NU-143S	Nucleic acids: 6Cl-GTP, S pack	50Units	128-Eur	Jena Bio
NU-143L	Nucleic acids: 6Cl-GTP, L pack	250Units	316-Eur	Jena Bio
NU-139S	Nucleic acids: 5I-CTP, S pack	50Units	128-Eur	Jena Bio
NU-139L	Nucleic acids: 5I-CTP, L pack	250Units	316-Eur	Jena Bio
NU-138S	Nucleic acids: 5I-CDP, S pack	30Units	128-Eur	Jena Bio
NU-138L	Nucleic acids: 5I-CDP, L pack	150Units	316-Eur	Jena Bio
NU-137S	Nucleic acids: 8Br-3'_5'-pAp, S pack	30Units	128-Eur	Jena Bio
NU-137L	Nucleic acids: 8Br-3'_5'-pAp, L pack	150Units	316-Eur	Jena Bio
NU-144L	Nucleic acids: 8Br-GMP, L pack	500Units	316-Eur	Jena Bio
NU-144S	Nucleic acids: 8Br-GMP, S pack	100Units	128-Eur	Jena Bio
NU-145L	Nucleic acids: 2F-ATP, L pack	100Units	331-Eur	Jena Bio
NU-833-CY3	Nucleic acids: gamma-[6-Aminohexyl]-ATP - Cy3	40	209-Eur	Jena Bio
NU-148S	Nucleic acids: 2'Cl-ATP, S pack	50Units	128-Eur	Jena Bio
NU-148L	Nucleic acids: 2'Cl-ATP, L pack	250Units	316-Eur	Jena Bio
NU-147S	Nucleic acids: 2'I-AMP, S pack	50Units	128-Eur	Jena Bio
NU-147L	Nucleic acids: 2'I-AMP, L pack	250Units	316-Eur	Jena Bio
NU-146S	Nucleic acids: 5F-UMP, S pack	50Units	128-Eur	Jena Bio
NU-146L	Nucleic acids: 5F-UMP, L pack	250Units	316-Eur	Jena Bio
NU-145S	Nucleic acids: 2F-ATP, S pack	20Units	133-Eur	Jena Bio
NU-136S	Nucleic acids: 8Br-2'_5'-pAp, S pack	30Units	128-Eur	Jena Bio
NU-136L	Nucleic acids: 8Br-2'_5'-pAp, L pack	150Units	316-Eur	Jena Bio
NU-135S	Nucleic acids: 5Br-UMP, S pack	100Units	128-Eur	Jena Bio
NU-123S	Nucleic acids: 8I-GDP, S pack	30Units	128-Eur	Jena Bio
NU-123L	Nucleic acids: 8I-GDP, L pack	150Units	316-Eur	Jena Bio
NU-1206-500	Nucleic acids: UDP, lyophilized - 500 mg	500mg	197-Eur	Jena Bio
NU-1206-100	Nucleic acids: UDP, lyophilized - 100 mg	100mg	74-Eur	Jena Bio
NU-831-TXR	Nucleic acids: 5-Propargylamino-CTP - Texas Red	120	746-Eur	Jena Bio
NU-831-TAM	Nucleic acids: 5-Propargylamino-CTP - 5_6-TAMRA	30	209-Eur	Jena Bio
NU-1203S	Nucleic acids: ITP, S pack	150Units	128-Eur	Jena Bio
NU-1203L	Nucleic acids: ITP, L pack	750Units	316-Eur	Jena Bio
NU-124L	Nucleic acids: 8Br-GDP, L pack	250Units	316-Eur	Jena Bio
NU-124S	Nucleic acids: 8Br-GDP, S pack	50Units	128-Eur	Jena Bio
NU-125L	Nucleic acids: 8I-GTP, L pack	150Units	316-Eur	Jena Bio
NU-135L	Nucleic acids: 5Br-UMP, L pack	500Units	316-Eur	Jena Bio
NU-833-776	Nucleic acids: gamma-[6-Aminohexyl]-ATP - DY-776	80	746-Eur	Jena Bio
NU-833-751	Nucleic acids: gamma-[6-Aminohexyl]-ATP - DY-751	80	746-Eur	Jena Bio
NU-833-6FM	Nucleic acids: gamma-[6-Aminohexyl]-ATP - 6-FAM	160	746-Eur	Jena Bio
NU-131S	Nucleic acids: 5Br-CTP, S pack	50Units	128-Eur	Jena Bio
NU-131L	Nucleic acids: 5Br-CTP, L pack	250Units	316-Eur	Jena Bio
NU-833-5FM	Nucleic acids: gamma-[6-Aminohexyl]-ATP - 5-FAM	40	209-Eur	Jena Bio
NU-125S	Nucleic acids: 8I-GTP, S pack	30Units	128-Eur	Jena Bio
NU-1202S	Nucleic acids: IDP, S pack	100Units	128-Eur	Jena Bio
S015-1KG	Amino Acids,L-Serine	1KG	228-Eur	Caisson Laboratory
G007-1KG	Amino Acids,Glycine	1KG	79-Eur	Caisson Laboratory
NU-850-6FM	Nucleic acids: 5-Propargylamino-ddCTP - 6-FAM	30	209-Eur	Jena Bio
G010-1KG	Amino Acids,L-Glutamine	1KG	99-Eur	Caisson Laboratory
NU-850-776	Nucleic acids: 5-Propargylamino-ddCTP - DY-776	80	746-Eur	Jena Bio
NU-850-CY3	Nucleic acids: 5-Propargylamino-ddCTP - Cy3	60	209-Eur	Jena Bio
NU-850-CY5	Nucleic acids: 5-Propargylamino-ddCTP - Cy5	60	209-Eur	Jena Bio
NU-850-JOE	Nucleic acids: 5-Propargylamino-ddCTP - 6-JOE	240	746-Eur	Jena Bio
C019-1KG	Amino Acids,L-Cystine	1KG	98-Eur	Caisson Laboratory
NU-850-5FM	Nucleic acids: 5-Propargylamino-ddCTP - 5-FAM	60	209-Eur	Jena Bio
NU-836L	Nucleic acids: EDA-ITP, L pack	500Units	316-Eur	Jena Bio
NU-836S	Nucleic acids: EDA-ITP, S pack	100Units	128-Eur	Jena Bio
P015-1KG	Amino Acids,L-Proline	1KG	249-Eur	Caisson Laboratory
M018-1KG	Amino Acids,L-Methionine	1KG	216-Eur	Caisson Laboratory
NU-840S	Nucleic acids: EDA-GDP, S pack	50Units	128-Eur	Jena Bio
NU-840L	Nucleic acids: EDA-GDP, L pack	250Units	316-Eur	Jena Bio
NU-838S	Nucleic acids: EDA-XTP, S pack	100Units	128-Eur	Jena Bio
NU-838L	Nucleic acids: EDA-XTP, L pack	500Units	316-Eur	Jena Bio
NU-837S	Nucleic acids: EDA-IDP, S pack	50Units	128-Eur	Jena Bio
NU-837L	Nucleic acids: EDA-IDP, L pack	250Units	316-Eur	Jena Bio
NU-850-ROX	Nucleic acids: 5-Propargylamino-ddCTP - 6-ROX	60	209-Eur	Jena Bio
C018-1KG	Amino Acids,L-Cystine	1KG	350-Eur	Caisson Laboratory
C004-1KG	Peptone,Casamino Acids	1KG	154-Eur	Caisson Laboratory
NU-834-776	Nucleic acids: gamma-[6-Aminohexyl]-GTP - DY-776	80	746-Eur	Jena Bio
NU-834-751	Nucleic acids: gamma-[6-Aminohexyl]-GTP - DY-751	80	746-Eur	Jena Bio
NU-925-6FM-L	Nucleic acids: 6-FAM-dC-puromycin, L pack	500	316-Eur	Jena Bio
NU-925-6FM-S	Nucleic acids: 6-FAM-dC-puromycin, S pack	100	128-Eur	Jena Bio
NU-834-6FM	Nucleic acids: gamma-[6-Aminohexyl]-GTP - 6-FAM	160	746-Eur	Jena Bio
NU-928-1	Nucleic acids: 2'MeSe-ATP, 1 mg pack	1mg	330-Eur	Jena Bio
NU-834-5FM	Nucleic acids: gamma-[6-Aminohexyl]-GTP - 5-FAM	160	746-Eur	Jena Bio
NU-152L	Nucleic acids: 2'F-AMP, L pack	250Units	316-Eur	Jena Bio
NU-834-CY3	Nucleic acids: gamma-[6-Aminohexyl]-GTP - Cy3	160	746-Eur	Jena Bio
NU-834-CY5	Nucleic acids: gamma-[6-Aminohexyl]-GTP - Cy5	80	209-Eur	Jena Bio
NU-515	Nucleic acids: ApCpp(Nic), pack	300Units	933-Eur	Jena Bio
NU-1609-6FM	Nucleic acids: EDA-ATPgammaS - 6-FAM	50	1714-Eur	Jena Bio
A011-1KG	Amino Acids,L-Arginine HCl	1KG	150-Eur	Caisson Laboratory
NU-1609-5FM	Nucleic acids: EDA-ATPgammaS - 5-FAM	50	1714-Eur	Jena Bio
A019-1KG	Amino Acids,L-Alanine	1KG	190-Eur	Caisson Laboratory
NU-905-1	Nucleic acids: 2I-ATPgammaS, 1 mg pack	1mg	128-Eur	Jena Bio
NU-905-5	Nucleic acids: 2I-ATPgammaS, 5 mg pack	5mg	316-Eur	Jena Bio
NU-834-ROX	Nucleic acids: gamma-[6-Aminohexyl]-GTP - 6-ROX	160	746-Eur	Jena Bio
NU-834-JOE	Nucleic acids: gamma-[6-Aminohexyl]-GTP - 6-JOE	160	746-Eur	Jena Bio
NU-833-JOE	Nucleic acids: gamma-[6-Aminohexyl]-ATP - 6-JOE	160	746-Eur	Jena Bio
NU-827-665	Nucleic acids: EDA-m7GDP - ATTO-665	400	746-Eur	Jena Bio
NU-827-488	Nucleic acids: EDA-m7GDP - ATTO-488	80	746-Eur	Jena Bio
NU-827-465	Nucleic acids: EDA-m7GDP - ATTO-465	120	746-Eur	Jena Bio
NU-827-425	Nucleic acids: EDA-m7GDP - ATTO-425	120	746-Eur	Jena Bio
NU-827-390	Nucleic acids: EDA-m7GDP - ATTO-390	80	746-Eur	Jena Bio
NU-824-TXR	Nucleic acids: EDA-m7GTP - Texas Red	40	209-Eur	Jena Bio
NU-824-TAM	Nucleic acids: EDA-m7GTP - 5_6-TAMRA	160	746-Eur	Jena Bio
NU-824-MNT	Nucleic acids: EDA-m7GTP - MANT	200	746-Eur	Jena Bio
NU-824-MB2	Nucleic acids: EDA-m7GTP - ATTO-MB2	40	746-Eur	Jena Bio
NU-827-495	Nucleic acids: EDA-m7GDP - ATTO-495	80	746-Eur	Jena Bio
NU-827-532	Nucleic acids: EDA-m7GDP - ATTO-532	80	746-Eur	Jena Bio
NU-827-550	Nucleic acids: EDA-m7GDP - ATTO-550	80	746-Eur	Jena Bio
NU-827-660Q	Nucleic acids: EDA-m7GDP - DYQ-660	40	746-Eur	Jena Bio
NU-827-656	Nucleic acids: EDA-m7GDP - OYSTER-656	40	746-Eur	Jena Bio
NU-827-655	Nucleic acids: EDA-m7GDP - ATTO-655	40	746-Eur	Jena Bio
NU-827-633	Nucleic acids: EDA-m7GDP - ATTO-633	40	746-Eur	Jena Bio
NU-827-620	Nucleic acids: EDA-m7GDP - ATTO-620	40	746-Eur	Jena Bio
NU-827-594	Nucleic acids: EDA-m7GDP - ATTO-594	40	746-Eur	Jena Bio
NU-827-590	Nucleic acids: EDA-m7GDP - ATTO-590	120	746-Eur	Jena Bio
NU-827-565	Nucleic acids: EDA-m7GDP - ATTO-565	120	746-Eur	Jena Bio
NU-831-656	Nucleic acids: 5-Propargylamino-CTP - OYSTER-656	40	746-Eur	Jena Bio
NU-827-661Q	Nucleic acids: EDA-m7GDP - DYQ-661	40	746-Eur	Jena Bio
NU-824-740	Nucleic acids: EDA-m7GTP - ATTO-740	40	746-Eur	Jena Bio
NU-824-594	Nucleic acids: EDA-m7GTP - ATTO-594	80	746-Eur	Jena Bio
NU-824-590	Nucleic acids: EDA-m7GTP - ATTO-590	120	746-Eur	Jena Bio
NU-824-565	Nucleic acids: EDA-m7GTP - ATTO-565	120	746-Eur	Jena Bio
NU-824-550	Nucleic acids: EDA-m7GTP - ATTO-550	20	209-Eur	Jena Bio
NU-824-532	Nucleic acids: EDA-m7GTP - ATTO-532	80	746-Eur	Jena Bio
NU-824-495	Nucleic acids: EDA-m7GTP - ATTO-495	80	746-Eur	Jena Bio
NU-824-488	Nucleic acids: EDA-m7GTP - ATTO-488	20	209-Eur	Jena Bio
NU-824-465	Nucleic acids: EDA-m7GTP - ATTO-465	120	746-Eur	Jena Bio
NU-824-620	Nucleic acids: EDA-m7GTP - ATTO-620	40	746-Eur	Jena Bio
NU-824-633	Nucleic acids: EDA-m7GTP - ATTO-633	10	209-Eur	Jena Bio
NU-824-655	Nucleic acids: EDA-m7GTP - ATTO-655	40	746-Eur	Jena Bio
NU-824-725	Nucleic acids: EDA-m7GTP - ATTO-725	40	746-Eur	Jena Bio
NU-824-700	Nucleic acids: EDA-m7GTP - ATTO-700	40	746-Eur	Jena Bio
NU-824-680	Nucleic acids: EDA-m7GTP - ATTO-680	40	746-Eur	Jena Bio
NU-824-665	Nucleic acids: EDA-m7GTP - ATTO-665	400	746-Eur	Jena Bio
NU-824-661Q	Nucleic acids: EDA-m7GTP - DYQ-661	40	746-Eur	Jena Bio
NU-1172-1G	Nucleic acids: GDP, lyophilized - 1 g	1g	342-Eur	Jena Bio
NU-824-660Q	Nucleic acids: EDA-m7GTP - DYQ-660	40	746-Eur	Jena Bio
NU-824-656	Nucleic acids: EDA-m7GTP - OYSTER-656	40	746-Eur	Jena Bio
NU-824-425	Nucleic acids: EDA-m7GTP - ATTO-425	120	746-Eur	Jena Bio
NU-1202L	Nucleic acids: IDP, L pack	500Units	316-Eur	Jena Bio
NU-1609-751	Nucleic acids: EDA-ATPgammaS - DY-751	50	1714-Eur	Jena Bio
NU-831-680	Nucleic acids: 5-Propargylamino-CTP - ATTO-680	10	209-Eur	Jena Bio
NU-118S	Nucleic acids: 8Br-GTP, S pack	50Units	133-Eur	Jena Bio
NU-118L	Nucleic acids: 8Br-GTP, L pack	250Units	331-Eur	Jena Bio
NU-831-665	Nucleic acids: 5-Propargylamino-CTP - ATTO-665	400	746-Eur	Jena Bio
NU-831-661Q	Nucleic acids: 5-Propargylamino-CTP - DYQ-661	40	746-Eur	Jena Bio
NU-831-660Q	Nucleic acids: 5-Propargylamino-CTP - DYQ-660	40	746-Eur	Jena Bio
NU-831-655	Nucleic acids: 5-Propargylamino-CTP - ATTO-655	40	746-Eur	Jena Bio
NU-831-725	Nucleic acids: 5-Propargylamino-CTP - ATTO-725	40	746-Eur	Jena Bio
NU-831-740	Nucleic acids: 5-Propargylamino-CTP - ATTO-740	40	746-Eur	Jena Bio
NU-831-MB2	Nucleic acids: 5-Propargylamino-CTP - ATTO-MB2	40	746-Eur	Jena Bio
NU-1201S	Nucleic acids: IMP, S pack	150Units	128-Eur	Jena Bio
NU-1201L	Nucleic acids: IMP, L pack	750Units	316-Eur	Jena Bio
NU-119S	Nucleic acids: 5I-UTP, S pack	50Units	128-Eur	Jena Bio
NU-119L	Nucleic acids: 5I-UTP, L pack	250Units	316-Eur	Jena Bio
NU-1199-100	Nucleic acids: CDP, lyophilized - 100 mg	100mg	247-Eur	Jena Bio
NU-1198-5G	Nucleic acids: ADP, lyophilized - 5 g	5g	264-Eur	Jena Bio
NU-1198-1G	Nucleic acids: ADP, lyophilized - 1 g	1g	91-Eur	Jena Bio
NU-831-MNT	Nucleic acids: 5-Propargylamino-CTP - MANT	100	746-Eur	Jena Bio
NU-831-633	Nucleic acids: 5-Propargylamino-CTP - ATTO-633	40	746-Eur	Jena Bio
NU-831-620	Nucleic acids: 5-Propargylamino-CTP - ATTO-620	40	746-Eur	Jena Bio
NU-831-594	Nucleic acids: 5-Propargylamino-CTP - ATTO-594	40	746-Eur	Jena Bio
NU-827-TXR	Nucleic acids: EDA-m7GDP - Texas Red	160	746-Eur	Jena Bio
NU-827-TAM	Nucleic acids: EDA-m7GDP - 5_6-TAMRA	160	746-Eur	Jena Bio
NU-827-MNT	Nucleic acids: EDA-m7GDP - MANT	200	746-Eur	Jena Bio
NU-827-MB2	Nucleic acids: EDA-m7GDP - ATTO-MB2	40	746-Eur	Jena Bio
NU-827-740	Nucleic acids: EDA-m7GDP - ATTO-740	40	746-Eur	Jena Bio
NU-827-725	Nucleic acids: EDA-m7GDP - ATTO-725	40	746-Eur	Jena Bio
NU-827-700	Nucleic acids: EDA-m7GDP - ATTO-700	40	746-Eur	Jena Bio
NU-1172-5G	Nucleic acids: GDP, lyophilized - 5 g	5g	838-Eur	Jena Bio
NU-831-390	Nucleic acids: 5-Propargylamino-CTP - ATTO-390	80	746-Eur	Jena Bio
NU-831-425	Nucleic acids: 5-Propargylamino-CTP - ATTO-425	80	746-Eur	Jena Bio
NU-831-465	Nucleic acids: 5-Propargylamino-CTP - ATTO-465	80	746-Eur	Jena Bio
NU-831-590	Nucleic acids: 5-Propargylamino-CTP - ATTO-590	80	746-Eur	Jena Bio
NU-1184S	Nucleic acids: 2'OMe-ATP, S pack	100Units	128-Eur	Jena Bio
NU-1184L	Nucleic acids: 2'OMe-ATP, L pack	500Units	316-Eur	Jena Bio
NU-831-565	Nucleic acids: 5-Propargylamino-CTP - ATTO-565	80	746-Eur	Jena Bio
NU-831-550	Nucleic acids: 5-Propargylamino-CTP - ATTO-550	80	746-Eur	Jena Bio
NU-831-532	Nucleic acids: 5-Propargylamino-CTP - ATTO-532	80	746-Eur	Jena Bio
NU-831-495	Nucleic acids: 5-Propargylamino-CTP - ATTO-495	80	746-Eur	Jena Bio
NU-831-488	Nucleic acids: 5-Propargylamino-CTP - ATTO-488	80	746-Eur	Jena Bio
NU-827-680	Nucleic acids: EDA-m7GDP - ATTO-680	40	746-Eur	Jena Bio
NU-109L	Nucleic acids: 2'I-ADP, L pack	150Units	316-Eur	Jena Bio
NU-510L	Nucleic acids: AP4(8I-G), L pack	150Units	316-Eur	Jena Bio
NK-105	Nucleic acids: 6-Methylthio-Inosine Kit	1Kit	194-Eur	Jena Bio
NK-106	Nucleic acids: 4-Thio-Uridine Kit	1Kit	194-Eur	Jena Bio
NU-221S	Nucleic acids: TNP-ATP, S pack	150Units	133-Eur	Jena Bio
NU-222L	Nucleic acids: TNP-ADP, L pack	5	331-Eur	Jena Bio
NU-222S	Nucleic acids: TNP-ADP, S pack	1	133-Eur	Jena Bio
NU-805-ROX	Nucleic acids: N6-(6-Amino)hexyl-ATP - 6-ROX	160	746-Eur	Jena Bio
NU-224L	Nucleic acids: TNP-AMP, L pack	10	331-Eur	Jena Bio
NU-224S	Nucleic acids: TNP-AMP, S pack	2	133-Eur	Jena Bio
NU-805-JOE	Nucleic acids: N6-(6-Amino)hexyl-ATP - 6-JOE	160	746-Eur	Jena Bio
NU-805-CY5	Nucleic acids: N6-(6-Amino)hexyl-ATP - Cy5	160	746-Eur	Jena Bio
NU-805-CY3	Nucleic acids: N6-(6-Amino)hexyl-ATP - Cy3	40	209-Eur	Jena Bio
NU-225L	Nucleic acids: TNP-CTP, L pack	500Units	316-Eur	Jena Bio
NU-805-776	Nucleic acids: N6-(6-Amino)hexyl-ATP - DY-776	80	746-Eur	Jena Bio
NU-805-751	Nucleic acids: N6-(6-Amino)hexyl-ATP - DY-751	80	746-Eur	Jena Bio
NU-516	Nucleic acids: AP2Ribavirin, pack	300Units	933-Eur	Jena Bio
NU-517	Nucleic acids: dAP2(Nic), pack	300Units	933-Eur	Jena Bio
NU-225S	Nucleic acids: TNP-CTP, S pack	100Units	128-Eur	Jena Bio
NK-104	Nucleic acids: 6-Methylthio-Guanosine Kit	1Kit	194-Eur	Jena Bio
LNA-1000	Locked Nucleic Acids (LNA)	1	63-Eur	British Biocelle
NU-510S	Nucleic acids: AP4(8I-G), S pack	30Units	128-Eur	Jena Bio
NU-511L	Nucleic acids: AP5(8I-G), L pack	150Units	316-Eur	Jena Bio
NU-217L	Nucleic acids: TNP-GDP, L pack	5	316-Eur	Jena Bio
NU-217S	Nucleic acids: TNP-GDP, S pack	1	128-Eur	Jena Bio
NU-220L	Nucleic acids: TNP-GTP, L pack	5	316-Eur	Jena Bio
NU-511S	Nucleic acids: AP5(8I-G), S pack	30Units	128-Eur	Jena Bio
NU-404-1	Nucleic acids: XTPgammaS, 1 mg pack	1mg	211-Eur	Jena Bio
NU-220S	Nucleic acids: TNP-GTP, S pack	1	128-Eur	Jena Bio
NU-221L	Nucleic acids: TNP-ATP, L pack	750Units	331-Eur	Jena Bio
NU-808S	Nucleic acids: EDA-ATP, S pack	30Units	128-Eur	Jena Bio
NU-808L	Nucleic acids: EDA-ATP, L pack	150Units	316-Eur	Jena Bio
NU-808-BIO	Nucleic acids: EDA-ATP - Biotin, pack	50	180-Eur	Jena Bio
E02E0166	Rat Epoxyeicosatrienoic acids ELISA	96T/kit	692-Eur	Blue Gene Biotech	Elisa kits
NK-101	Nucleic acids: Non-hydrolyzable ATP Test Kit	5ATP analogs	221-Eur	Jena Bio
NK-102	Nucleic acids: Non-hydrolyzable GTP Test Kit	5GTP analogs	278-Eur	Jena Bio
NK-103	Nucleic acids: 6-Thio-Guanosine Kit	1Kit	194-Eur	Jena Bio
K 0293	Non-essential amino acids (NEA) (100 x)	5 x 100 ml	72-Eur	Biochro
NU-805-6FM	Nucleic acids: N6-(6-Amino)hexyl-ATP - 6-FAM	40	209-Eur	Jena Bio
NU-226L	Nucleic acids: TNP-UTP, L pack	500Units	316-Eur	Jena Bio
na	Boc_Amino acids Boc_protected amino a	1g	----Eur	chemotra
NU-803-JOE	Nucleic acids: Aminoallyl-dUTP - 6-JOE	120	746-Eur	Jena Bio
61788-66-7	Fatty acids ex vegetable_oil	1g	----Eur	chemotra
NU-803-CY5	Nucleic acids: Aminoallyl-dUTP - Cy5	30	209-Eur	Jena Bio
NU-803-776	Nucleic acids: Aminoallyl-dUTP - DY-776	100	746-Eur	Jena Bio
NU-803-751	Nucleic acids: Aminoallyl-dUTP - DY-751	40	746-Eur	Jena Bio
NK-109	Nucleic acids: 8-Oxo-2'-Deoxy-Guanosine Kit	1Kit	194-Eur	Jena Bio
NU-802-BIO	Nucleic acids: EDA-ADP - Biotin, pack	50	172-Eur	Jena Bio
NU-803-6FM	Nucleic acids: Aminoallyl-dUTP - 6-FAM	30	209-Eur	Jena Bio
10-002-38022	HSP 90 (amino acids 1-732) - HSP 86; NY-REN-38 antigen N_A	0.1 mg	489-Eur	GenWay
10-002-38022	HSP 90 (amino acids 1-732) - HSP 86; NY-REN-38 antigen N_A	1 mg	1253-Eur	GenWay
NK-108	Nucleic acids: 7-Methyl-Guanosine Kit	1Kit	194-Eur	Jena Bio
NU-802L	Nucleic acids: EDA-ADP, L pack	150Units	316-Eur	Jena Bio
NU-230L	Nucleic acids: Ant-GTP, L pack	750Units	316-Eur	Jena Bio
NU-230S	Nucleic acids: Ant-GTP, S pack	150Units	128-Eur	Jena Bio
NU-802S	Nucleic acids: EDA-ADP, S pack	30Units	128-Eur	Jena Bio
K 0293	Non_essential amino acids (NEA) (100 x)	100 ml	39-Eur	Biochro
077-67	short_chain fatty acids (Propionate, C3) _ 1gm	1 gram	111-Eur	Phoenix Peptide
NU-803-ROX	Nucleic acids: Aminoallyl-dUTP - 6-ROX	120	746-Eur	Jena Bio
NU-226S	Nucleic acids: TNP-UTP, S pack	100Units	128-Eur	Jena Bio
NU-805-5FM	Nucleic acids: N6-(6-Amino)hexyl-ATP - 5-FAM	40	209-Eur	Jena Bio
841	FRACTIONATED AMINO ACIDS, SERUM	1	49-Eur	Kenova
077-72	short_chain fatty acids (Acetate, C2) _ 1gm	1 gram	111-Eur	Phoenix Peptide
077-71	short_chain fatty acids (Heptanoate, C7) _ 1gm	1 gram	111-Eur	Phoenix Peptide
077-70	short_chain fatty acids (Hexanoate, C6) _ 1gm	1 gram	126-Eur	Phoenix Peptide
NK-107	Nucleic acids: 5-Methyl-2'-Deoxycytidine Kit	1Kit	194-Eur	Jena Bio
NU-601L	Nucleic acids: XDP, L pack	500Units	331-Eur	Jena Bio
NU-601S	Nucleic acids: XDP, S pack	100Units	133-Eur	Jena Bio
NU-602L	Nucleic acids: XTP, L pack	750Units	331-Eur	Jena Bio
NU-602S	Nucleic acids: XTP, S pack	150Units	133-Eur	Jena Bio
NU-603L	Nucleic acids: XMP, L pack	750Units	316-Eur	Jena Bio
077-69	short_chain fatty acids (Pentanoate, C5) _ 1gm	1 gram	117-Eur	Phoenix Peptide
1837	ORGANIC ACIDS, URINE	1	163-Eur	Kenova
NU-603S	Nucleic acids: XMP, S pack	150Units	128-Eur	Jena Bio
XC-E1152/100	MEM Amino Acids 50X w_o L_Glutamine _ 100 ml	100 ml	71-Eur	Biosera
NK-114	Nucleic acids: 3'-Deoxy-Guanosine Kit	1Kit	194-Eur	Jena Bio
NU-803-5FM	Nucleic acids: Aminoallyl-dUTP - 5-FAM	30	209-Eur	Jena Bio
NU-1610-5FM	Nucleic acids: EDA-GTPgammaS - 5-FAM	50	1714-Eur	Jena Bio
NU-102L	Nucleic acids: 2'Br-ATP, L pack	150Units	316-Eur	Jena Bio
NU-1028-25G	Nucleic acids: GMP, lyophilized - 25 g	25g	176-Eur	Jena Bio
NU-1025-5G	Nucleic acids: AMP, lyophilized - 5 g	5g	57-Eur	Jena Bio
NU-1610-CY5	Nucleic acids: EDA-GTPgammaS - Cy5	50	1714-Eur	Jena Bio
NU-433-25	Nucleic acids: ADPbetaS, 25 mg pack	25mg	316-Eur	Jena Bio
NU-433-5	Nucleic acids: ADPbetaS, 5 mg pack	5mg	128-Eur	Jena Bio
NU-1025-25G	Nucleic acids: AMP, lyophilized - 25 g	25g	130-Eur	Jena Bio
NU-1610-CY3	Nucleic acids: EDA-GTPgammaS - Cy3	50	1714-Eur	Jena Bio
NU-809-6FM	Nucleic acids: 5-Propargylamino-dCTP - 6-FAM	30	209-Eur	Jena Bio
NU-416-1	Nucleic acids: UTPgammaS, 1 mg pack	1mg	128-Eur	Jena Bio
NU-1610-776	Nucleic acids: EDA-GTPgammaS - DY-776	50	1714-Eur	Jena Bio
NU-1610-751	Nucleic acids: EDA-GTPgammaS - DY-751	50	1714-Eur	Jena Bio
NU-1028-5G	Nucleic acids: GMP, lyophilized - 5 g	5g	66-Eur	Jena Bio
NU-1610-6FM	Nucleic acids: EDA-GTPgammaS - 6-FAM	50	1714-Eur	Jena Bio
NU-102S	Nucleic acids: 2'Br-ATP, S pack	30Units	128-Eur	Jena Bio
NU-1610-JOE	Nucleic acids: EDA-GTPgammaS - 6-JOE	50	1714-Eur	Jena Bio
NU-10704-10	Nucleic acids: 2Cl-dATP, 10	10	362-Eur	Jena Bio
NU-416-5	Nucleic acids: UTPgammaS, 5 mg pack	5mg	316-Eur	Jena Bio
NU-810-5FM	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - 5-FAM	120	746-Eur	Jena Bio
BI7982	BILE ACIDS COLORIMETRIC 5th GEN.	R1 6x50, R2 6x18	3107-Eur	RANDOX
NU-412-20	Nucleic acids: GTPgammaS, 20 mg pack	20mg	300-Eur	Jena Bio
NU-412-10	Nucleic acids: GTPgammaS, 10 mg pack	10mg	180-Eur	Jena Bio
BI2672	BILE ACIDS COLORIMETRIC 4th GEN.	R1 10x10, R2 1x30	1351-Eur	RANDOX
NU-427-1	Nucleic acids: GDPbetaS, 1 mg pack	1mg	128-Eur	Jena Bio
NU-427-5	Nucleic acids: GDPbetaS, 5 mg pack	5mg	316-Eur	Jena Bio
NU-10404-10	Nucleic acids: 2'F-dUTP, 10	10	201-Eur	Jena Bio
NU-10403-10	Nucleic acids: 2'F-dGTP, 10	10	201-Eur	Jena Bio
NU-10402-10	Nucleic acids: 2'F-dCTP, 10	10	201-Eur	Jena Bio
NU-1610-ROX	Nucleic acids: EDA-GTPgammaS - 6-ROX	50	1714-Eur	Jena Bio
NU-803-CY3	Nucleic acids: Aminoallyl-dUTP - Cy3	30	209-Eur	Jena Bio
NU-442-1	Nucleic acids: UDPbetaS, 1 mg pack	1mg	128-Eur	Jena Bio
NU-442-5	Nucleic acids: UDPbetaS, 5 mg pack	5mg	316-Eur	Jena Bio
NU-404-5	Nucleic acids: XTPgammaS, 5 mg pack	5mg	753-Eur	Jena Bio
NU-809-JOE	Nucleic acids: 5-Propargylamino-dCTP - 6-JOE	120	746-Eur	Jena Bio
NU-809-CY5	Nucleic acids: 5-Propargylamino-dCTP - Cy5	30	209-Eur	Jena Bio
NU-809-CY3	Nucleic acids: 5-Propargylamino-dCTP - Cy3	30	209-Eur	Jena Bio
NU-809-776	Nucleic acids: 5-Propargylamino-dCTP - DY-776	40	746-Eur	Jena Bio
NU-809-751	Nucleic acids: 5-Propargylamino-dCTP - DY-751	40	746-Eur	Jena Bio
NU-809-5FM	Nucleic acids: 5-Propargylamino-dCTP - 5-FAM	30	209-Eur	Jena Bio
NU-406-50	Nucleic acids: ATPgammaS, 50 mg pack	50mg	300-Eur	Jena Bio
NU-809-ROX	Nucleic acids: 5-Propargylamino-dCTP - 6-ROX	120	746-Eur	Jena Bio
NU-101L	Nucleic acids: 2'I-ATP, L pack	150Units	331-Eur	Jena Bio
NU-406-25	Nucleic acids: ATPgammaS, 25 mg pack	25mg	180-Eur	Jena Bio
NU-411S	Nucleic acids: UTPalphaS, S pack	25	128-Eur	Jena Bio
NU-307L	Nucleic acids: NPE-caged-XDP, L pack	50Units	316-Eur	Jena Bio
NU-833-620	Nucleic acids: gamma-[6-Aminohexyl]-ATP - ATTO-620	80	746-Eur	Jena Bio
NU-831S	Nucleic acids: 5-Propargylamino-CTP, S pack	30Units	128-Eur	Jena Bio
NU-402-5	Nucleic acids: GppCp, 5 mg pack (GMPPCP)	5mg	66-Eur	Jena Bio
NU-833-633	Nucleic acids: gamma-[6-Aminohexyl]-ATP - ATTO-633	80	746-Eur	Jena Bio
NU-411L	Nucleic acids: UTPalphaS, L pack	100	316-Eur	Jena Bio
NU-304S	Nucleic acids: NPE-caged-XTP, S pack	10Units	128-Eur	Jena Bio
NU-833-655	Nucleic acids: gamma-[6-Aminohexyl]-ATP - ATTO-655	80	746-Eur	Jena Bio
NU-301L	Nucleic acids: NPE-caged-ATP, L pack	750Units	331-Eur	Jena Bio
NU-301S	Nucleic acids: NPE-caged-ATP, S pack	150Units	133-Eur	Jena Bio
NU-302L	Nucleic acids: NPE-caged-GTP, L pack	500Units	331-Eur	Jena Bio
NU-302S	Nucleic acids: NPE-caged-GTP, S pack	100Units	133-Eur	Jena Bio
NU-304L	Nucleic acids: NPE-caged-XTP, L pack	50Units	316-Eur	Jena Bio
NU-421-25	Nucleic acids: ApCpp, 25 mg pack (AMPCPP)	25mg	337-Eur	Jena Bio
NU-833-680	Nucleic acids: gamma-[6-Aminohexyl]-ATP - ATTO-680	80	746-Eur	Jena Bio
NU-421-10	Nucleic acids: ApCpp, 10 mg pack (AMPCPP)	10mg	185-Eur	Jena Bio
NU-833-665	Nucleic acids: gamma-[6-Aminohexyl]-ATP - ATTO-665	800	746-Eur	Jena Bio
NU-309S	Nucleic acids: DMB-caged-ATP, S pack	10Units	128-Eur	Jena Bio
NU-833-661Q	Nucleic acids: gamma-[6-Aminohexyl]-ATP - DYQ-661	80	746-Eur	Jena Bio
NU-833-660Q	Nucleic acids: gamma-[6-Aminohexyl]-ATP - DYQ-660	80	746-Eur	Jena Bio
NU-413S	Nucleic acids: ITPgammaS, S pack	20Units	128-Eur	Jena Bio
NU-413L	Nucleic acids: ITPgammaS, L pack	100Units	316-Eur	Jena Bio
NU-833-656	Nucleic acids: gamma-[6-Aminohexyl]-ATP - OYSTER-656	800	746-Eur	Jena Bio
NU-237S	Nucleic acids: Mant-GMP, S pack	150Units	128-Eur	Jena Bio
NU-307S	Nucleic acids: NPE-caged-XDP, S pack	10Units	128-Eur	Jena Bio
NU-833-740	Nucleic acids: gamma-[6-Aminohexyl]-ATP - ATTO-740	80	746-Eur	Jena Bio
NU-833-725	Nucleic acids: gamma-[6-Aminohexyl]-ATP - ATTO-725	80	746-Eur	Jena Bio
NU-833-550	Nucleic acids: gamma-[6-Aminohexyl]-ATP - ATTO-550	120	746-Eur	Jena Bio
NU-833-700	Nucleic acids: gamma-[6-Aminohexyl]-ATP - ATTO-700	80	746-Eur	Jena Bio
NU-402-25	Nucleic acids: GppCp, 25 mg pack (GMPPCP)	25mg	143-Eur	Jena Bio
NU-833-390	Nucleic acids: gamma-[6-Aminohexyl]-ATP - ATTO-390	120	746-Eur	Jena Bio
NU-409S	Nucleic acids: GTPalphaS, S pack	25	133-Eur	Jena Bio
NU-409L	Nucleic acids: GTPalphaS, L pack	100	331-Eur	Jena Bio
NU-833-532	Nucleic acids: gamma-[6-Aminohexyl]-ATP - ATTO-532	30	209-Eur	Jena Bio
NU-833-465	Nucleic acids: gamma-[6-Aminohexyl]-ATP - ATTO-465	120	746-Eur	Jena Bio
NU-833-495	Nucleic acids: gamma-[6-Aminohexyl]-ATP - ATTO-495	30	209-Eur	Jena Bio
NU-401-50	Nucleic acids: GppNHp, 50 mg pack (GMPPNP)	50mg	331-Eur	Jena Bio
NU-401-10	Nucleic acids: GppNHp, 10 mg pack (GMPPNP)	10mg	124-Eur	Jena Bio
NU-309L	Nucleic acids: DMB-caged-ATP, L pack	50Units	316-Eur	Jena Bio
NU-833-425	Nucleic acids: gamma-[6-Aminohexyl]-ATP - ATTO-425	120	746-Eur	Jena Bio
NU-407-10	Nucleic acids: AppNHp, 10 mg pack (AMPPNP)	10mg	80-Eur	Jena Bio
NU-407-50	Nucleic acids: AppNHp, 50 mg pack (AMPPNP)	50mg	230-Eur	Jena Bio
NU-408L	Nucleic acids: ATPalphaS, L pack	100	316-Eur	Jena Bio
NU-833-594	Nucleic acids: gamma-[6-Aminohexyl]-ATP - ATTO-594	80	746-Eur	Jena Bio
NU-408S	Nucleic acids: ATPalphaS, S pack	25	128-Eur	Jena Bio
NU-833-590	Nucleic acids: gamma-[6-Aminohexyl]-ATP - ATTO-590	30	209-Eur	Jena Bio
NU-410S	Nucleic acids: dTTPalphaS, S pack	100Units	128-Eur	Jena Bio
NU-410L	Nucleic acids: dTTPalphaS, L pack	500Units	316-Eur	Jena Bio
NU-833-565	Nucleic acids: gamma-[6-Aminohexyl]-ATP - ATTO-565	120	746-Eur	Jena Bio
NU-833-488	Nucleic acids: gamma-[6-Aminohexyl]-ATP - ATTO-488	30	209-Eur	Jena Bio
NU-213L	Nucleic acids: Mant-XTP, L pack	50Units	316-Eur	Jena Bio
NU-204S	Nucleic acids: Mant-GDP, S pack	150Units	133-Eur	Jena Bio
NU-835-6FM	Nucleic acids: N6-(6-Amino)hexyl-dATP - 6-FAM	40	209-Eur	Jena Bio
NU-204L	Nucleic acids: Mant-GDP, L pack	750Units	331-Eur	Jena Bio
NU-202S	Nucleic acids: Mant-ATP, S pack	150Units	133-Eur	Jena Bio
NU-202L	Nucleic acids: Mant-ATP, L pack	750Units	331-Eur	Jena Bio
NU-201S	Nucleic acids: Mant-ADP, S pack	150Units	133-Eur	Jena Bio
G010-100GM	Amino Acids,L-Glutamine	100GM	71-Eur	Caisson Laboratory
NU-201L	Nucleic acids: Mant-ADP, L pack	750Units	331-Eur	Jena Bio
NU-835-751	Nucleic acids: N6-(6-Amino)hexyl-dATP - DY-751	40	746-Eur	Jena Bio
NU-835-776	Nucleic acids: N6-(6-Amino)hexyl-dATP - DY-776	40	746-Eur	Jena Bio
NU-206L	Nucleic acids: Mant-GTP, L pack	750Units	331-Eur	Jena Bio
C019-500GM	Amino Acids,L-Cystine	500G	97-Eur	Caisson Laboratory
C019-100GM	Amino Acids,L-Cystine	100G	97-Eur	Caisson Laboratory
A031-1KG	Amino Acids,L-Asparagine, Anhydrous	1KG	203-Eur	Caisson Laboratory
A013-1KG	Amino Acids,L-Aspartic Acid	1KG	117-Eur	Caisson Laboratory
NU-1609-700	Nucleic acids: EDA-ATPgammaS - ATTO-700	50	1714-Eur	Jena Bio
NU-835-5FM	Nucleic acids: N6-(6-Amino)hexyl-dATP - 5-FAM	320	746-Eur	Jena Bio
L005-500GM	Amino Acids,L-Leucine	500G	133-Eur	Caisson Laboratory
NU-210S	Nucleic acids: Mant-XDP, S pack	10Units	128-Eur	Jena Bio
C018-100GM	Amino Acids,L-Cystine	100G	89-Eur	Caisson Laboratory
C018-500GM	Amino Acids,L-Cystine	500G	215-Eur	Caisson Laboratory
NU-210L	Nucleic acids: Mant-XDP, L pack	50Units	316-Eur	Jena Bio
NU-206S	Nucleic acids: Mant-GTP, S pack	150Units	133-Eur	Jena Bio
NU-1703	Nucleic acids: gamma-(BBT)-GTP, 1 mg pack	1mg	139-Eur	Jena Bio
G007-100GM	Amino Acids,Glycine	100G	64-Eur	Caisson Laboratory
NU-1619-776	Nucleic acids: 5-Propargylamino-ddUTP - DY-776	80	746-Eur	Jena Bio
NU-839L	Nucleic acids: EDA-m7GP5G, L pack	50Units	316-Eur	Jena Bio
NU-839S	Nucleic acids: EDA-m7GP5G, S pack	10Units	128-Eur	Jena Bio
NU-1619-751	Nucleic acids: 5-Propargylamino-ddUTP - DY-751	80	746-Eur	Jena Bio
NU-436L	Nucleic acids: CTPalphaS, L pack	100	316-Eur	Jena Bio
M018-100GM	Amino Acids,L-Methionine	100G	72-Eur	Caisson Laboratory
M018-500GM	Amino Acids,L-Methionine	500G	139-Eur	Caisson Laboratory
P015-100GM	Amino Acids,L-Proline	100G	77-Eur	Caisson Laboratory
P015-500GM	Amino Acids,L-Proline	500G	154-Eur	Caisson Laboratory
NU-1619-6FM	Nucleic acids: 5-Propargylamino-ddUTP - 6-FAM	60	209-Eur	Jena Bio
NU-1619-CY3	Nucleic acids: 5-Propargylamino-ddUTP - Cy3	60	209-Eur	Jena Bio
NU-1619-CY5	Nucleic acids: 5-Propargylamino-ddUTP - Cy5	60	209-Eur	Jena Bio
NU-1619-JOE	Nucleic acids: 5-Propargylamino-ddUTP - 6-JOE	240	746-Eur	Jena Bio
NU-835-CY3	Nucleic acids: N6-(6-Amino)hexyl-dATP - Cy3	160	746-Eur	Jena Bio
NU-835-CY5	Nucleic acids: N6-(6-Amino)hexyl-dATP - Cy5	160	746-Eur	Jena Bio
NU-835-JOE	Nucleic acids: N6-(6-Amino)hexyl-dATP - 6-JOE	160	746-Eur	Jena Bio
NU-1700	Nucleic acids: gamma-(BBT)-ATP, 1 mg pack	1mg	139-Eur	Jena Bio
L005-100GM	Amino Acids,L-Leucine	100G	73-Eur	Caisson Laboratory
NU-835-ROX	Nucleic acids: N6-(6-Amino)hexyl-dATP - 6-ROX	160	746-Eur	Jena Bio
NU-1620-5	Nucleic acids: BzBzATP (BzATP), 5 mg	5mg	94-Eur	Jena Bio
L006-1KG	Amino Acids,L-Lysine, Hydrochloride	1KG	92-Eur	Caisson Laboratory
NU-1620-25	Nucleic acids: BzBzATP (BzATP), 25 mg	25mg	258-Eur	Jena Bio
NU-1619-ROX	Nucleic acids: 5-Propargylamino-ddUTP - 6-ROX	240	746-Eur	Jena Bio
NU-1619-5FM	Nucleic acids: 5-Propargylamino-ddUTP - 5-FAM	60	209-Eur	Jena Bio
NU-237L	Nucleic acids: Mant-GMP, L pack	750Units	331-Eur	Jena Bio
NU-834-390	Nucleic acids: gamma-[6-Aminohexyl]-GTP - ATTO-390	120	746-Eur	Jena Bio
NU-229L	Nucleic acids: Ant-m7GMP, L pack	500Units	316-Eur	Jena Bio
NU-834-425	Nucleic acids: gamma-[6-Aminohexyl]-GTP - ATTO-425	120	746-Eur	Jena Bio
NU-834-465	Nucleic acids: gamma-[6-Aminohexyl]-GTP - ATTO-465	120	746-Eur	Jena Bio
NU-834-488	Nucleic acids: gamma-[6-Aminohexyl]-GTP - ATTO-488	120	746-Eur	Jena Bio
NU-834-495	Nucleic acids: gamma-[6-Aminohexyl]-GTP - ATTO-495	120	746-Eur	Jena Bio
NU-834-532	Nucleic acids: gamma-[6-Aminohexyl]-GTP - ATTO-532	30	209-Eur	Jena Bio
NU-834-550	Nucleic acids: gamma-[6-Aminohexyl]-GTP - ATTO-550	120	746-Eur	Jena Bio
NU-834-565	Nucleic acids: gamma-[6-Aminohexyl]-GTP - ATTO-565	120	746-Eur	Jena Bio
NU-228S	Nucleic acids: Ant-m7GDP, S pack	100Units	128-Eur	Jena Bio
NU-833-TXR	Nucleic acids: gamma-[6-Aminohexyl]-ATP - Texas Red	160	746-Eur	Jena Bio
NU-833-TAM	Nucleic acids: gamma-[6-Aminohexyl]-ATP - 5_6-TAMRA	40	209-Eur	Jena Bio
A019-100GM	Amino Acids,L-Alanine	100G	80-Eur	Caisson Laboratory
NU-236S	Nucleic acids: Mant-AMP, S pack	150Units	133-Eur	Jena Bio
NU-236L	Nucleic acids: Mant-AMP, L pack	750Units	331-Eur	Jena Bio
NU-1613L	Nucleic acids: EDA-6-Thio-GTP, L pack	250Units	316-Eur	Jena Bio
NU-1613S	Nucleic acids: EDA-6-Thio-GTP, S pack	50Units	128-Eur	Jena Bio
NU-1614L	Nucleic acids: EDA-6-Thio-GMP, L pack	250Units	316-Eur	Jena Bio
NU-1614S	Nucleic acids: EDA-6-Thio-GMP, S pack	50Units	128-Eur	Jena Bio
NU-1609-725	Nucleic acids: EDA-ATPgammaS - ATTO-725	50	1714-Eur	Jena Bio
NU-833-MB2	Nucleic acids: gamma-[6-Aminohexyl]-ATP - ATTO-MB2	40	746-Eur	Jena Bio
NU-833-MNT	Nucleic acids: gamma-[6-Aminohexyl]-ATP - MANT	200	746-Eur	Jena Bio
NU-229S	Nucleic acids: Ant-m7GMP, S pack	100Units	128-Eur	Jena Bio
NU-834-590	Nucleic acids: gamma-[6-Aminohexyl]-GTP - ATTO-590	120	746-Eur	Jena Bio
NU-834-594	Nucleic acids: gamma-[6-Aminohexyl]-GTP - ATTO-594	80	746-Eur	Jena Bio
NU-834-740	Nucleic acids: gamma-[6-Aminohexyl]-GTP - ATTO-740	80	746-Eur	Jena Bio
NU-834-BIO	Nucleic acids: gamma-[6-Aminohexyl]-GTP - Biotin	50	172-Eur	Jena Bio
A019-500GM	Amino Acids,L-Alanine	500G	130-Eur	Caisson Laboratory
NU-834-MB2	Nucleic acids: gamma-[6-Aminohexyl]-GTP - ATTO-MB2	40	746-Eur	Jena Bio
NU-834-MNT	Nucleic acids: gamma-[6-Aminohexyl]-GTP - MANT	200	746-Eur	Jena Bio
NU-1609-740	Nucleic acids: EDA-ATPgammaS - ATTO-740	50	1714-Eur	Jena Bio
NU-834-TAM	Nucleic acids: gamma-[6-Aminohexyl]-GTP - 5_6-TAMRA	160	746-Eur	Jena Bio
NU-834-TXR	Nucleic acids: gamma-[6-Aminohexyl]-GTP - Texas Red	160	746-Eur	Jena Bio
NU-213S	Nucleic acids: Mant-XTP, S pack	10Units	128-Eur	Jena Bio
A011-25GM	Amino Acids,L-Arginine HCl	25G	64-Eur	Caisson Laboratory
NU-834-725	Nucleic acids: gamma-[6-Aminohexyl]-GTP - ATTO-725	80	746-Eur	Jena Bio
NU-834-700	Nucleic acids: gamma-[6-Aminohexyl]-GTP - ATTO-700	80	746-Eur	Jena Bio
NU-834-680	Nucleic acids: gamma-[6-Aminohexyl]-GTP - ATTO-680	80	746-Eur	Jena Bio
NU-228L	Nucleic acids: Ant-m7GDP, L pack	500Units	316-Eur	Jena Bio
NU-834-620	Nucleic acids: gamma-[6-Aminohexyl]-GTP - ATTO-620	80	746-Eur	Jena Bio
NU-834-633	Nucleic acids: gamma-[6-Aminohexyl]-GTP - ATTO-633	80	746-Eur	Jena Bio
NU-834-655	Nucleic acids: gamma-[6-Aminohexyl]-GTP - ATTO-655	80	746-Eur	Jena Bio
NU-834-656	Nucleic acids: gamma-[6-Aminohexyl]-GTP - OYSTER-656	80	746-Eur	Jena Bio
NU-834-660Q	Nucleic acids: gamma-[6-Aminohexyl]-GTP - DYQ-660	80	746-Eur	Jena Bio
NU-227S	Nucleic acids: Ant-m7GTP, S pack	100Units	128-Eur	Jena Bio
NU-834-661Q	Nucleic acids: gamma-[6-Aminohexyl]-GTP - DYQ-661	80	746-Eur	Jena Bio
NU-834-665	Nucleic acids: gamma-[6-Aminohexyl]-GTP - ATTO-665	800	746-Eur	Jena Bio
NU-227L	Nucleic acids: Ant-m7GTP, L pack	500Units	316-Eur	Jena Bio
A011-100GM	Amino Acids,L-Arginine HCl	100G	70-Eur	Caisson Laboratory
NU-422-10	Nucleic acids: AppCp, 10 mg pack (AMPPCP)	10mg	72-Eur	Jena Bio
NU-809-700	Nucleic acids: 5-Propargylamino-dCTP - ATTO-700	40	746-Eur	Jena Bio
NU-809-532-XX	Nucleic acids: 5-Propargylamino-dCTP - ATTO-532-XX	40	746-Eur	Jena Bio
NU-809-532	Nucleic acids: 5-Propargylamino-dCTP - ATTO-532	20	209-Eur	Jena Bio
NU-809-495	Nucleic acids: 5-Propargylamino-dCTP - ATTO-495	20	209-Eur	Jena Bio
NU-809-488	Nucleic acids: 5-Propargylamino-dCTP - ATTO-488	20	209-Eur	Jena Bio
NU-809-465	Nucleic acids: 5-Propargylamino-dCTP - ATTO-465	80	746-Eur	Jena Bio
NU-809-425	Nucleic acids: 5-Propargylamino-dCTP - ATTO-425	80	746-Eur	Jena Bio
NU-809-390	Nucleic acids: 5-Propargylamino-dCTP - ATTO-390	80	746-Eur	Jena Bio
NU-805-TXR	Nucleic acids: N6-(6-Amino)hexyl-ATP - Texas Red	160	746-Eur	Jena Bio
NU-805-TAM	Nucleic acids: N6-(6-Amino)hexyl-ATP - 5_6-TAMRA	160	746-Eur	Jena Bio
NU-809-550	Nucleic acids: 5-Propargylamino-dCTP - ATTO-550	20	209-Eur	Jena Bio
NU-809-565	Nucleic acids: 5-Propargylamino-dCTP - ATTO-565	80	746-Eur	Jena Bio
NU-809-590	Nucleic acids: 5-Propargylamino-dCTP - ATTO-590	80	746-Eur	Jena Bio
NU-809-680	Nucleic acids: 5-Propargylamino-dCTP - ATTO-680	40	746-Eur	Jena Bio
NU-809-665	Nucleic acids: 5-Propargylamino-dCTP - ATTO-665	400	746-Eur	Jena Bio
NU-809-661Q	Nucleic acids: 5-Propargylamino-dCTP - DYQ-661	40	746-Eur	Jena Bio
NU-809-660Q	Nucleic acids: 5-Propargylamino-dCTP - DYQ-660	40	746-Eur	Jena Bio
NU-809-656	Nucleic acids: 5-Propargylamino-dCTP - OYSTER-656	40	746-Eur	Jena Bio
NU-809-655	Nucleic acids: 5-Propargylamino-dCTP - ATTO-655	10	209-Eur	Jena Bio
NU-809-633	Nucleic acids: 5-Propargylamino-dCTP - ATTO-633	40	746-Eur	Jena Bio
NU-809-620	Nucleic acids: 5-Propargylamino-dCTP - ATTO-620	40	746-Eur	Jena Bio
NU-809-594	Nucleic acids: 5-Propargylamino-dCTP - ATTO-594	40	746-Eur	Jena Bio
NU-1610-620	Nucleic acids: EDA-GTPgammaS - ATTO-620	50	1714-Eur	Jena Bio
NU-805-MNT	Nucleic acids: N6-(6-Amino)hexyl-ATP - MANT	200	746-Eur	Jena Bio
NU-805-633	Nucleic acids: N6-(6-Amino)hexyl-ATP - ATTO-633	20	209-Eur	Jena Bio
NU-805-620	Nucleic acids: N6-(6-Amino)hexyl-ATP - ATTO-620	80	746-Eur	Jena Bio
NU-805-594	Nucleic acids: N6-(6-Amino)hexyl-ATP - ATTO-594	80	746-Eur	Jena Bio
NU-805-590	Nucleic acids: N6-(6-Amino)hexyl-ATP - ATTO-590	120	746-Eur	Jena Bio
NU-805-565	Nucleic acids: N6-(6-Amino)hexyl-ATP - ATTO-565	30	209-Eur	Jena Bio
NU-805-550	Nucleic acids: N6-(6-Amino)hexyl-ATP - ATTO-550	30	209-Eur	Jena Bio
NU-805-532	Nucleic acids: N6-(6-Amino)hexyl-ATP - ATTO-532	30	209-Eur	Jena Bio
NU-805-495	Nucleic acids: N6-(6-Amino)hexyl-ATP - ATTO-495	30	209-Eur	Jena Bio
NU-805-488	Nucleic acids: N6-(6-Amino)hexyl-ATP - ATTO-488	30	209-Eur	Jena Bio
NU-805-655	Nucleic acids: N6-(6-Amino)hexyl-ATP - ATTO-655	80	746-Eur	Jena Bio
NU-805-656	Nucleic acids: N6-(6-Amino)hexyl-ATP - OYSTER-656	80	746-Eur	Jena Bio
NU-805-660Q	Nucleic acids: N6-(6-Amino)hexyl-ATP - DYQ-660	80	746-Eur	Jena Bio
NU-805-MB2	Nucleic acids: N6-(6-Amino)hexyl-ATP - ATTO-MB2	40	746-Eur	Jena Bio
NU-1610-633	Nucleic acids: EDA-GTPgammaS - ATTO-633	50	1714-Eur	Jena Bio
NU-1610-655	Nucleic acids: EDA-GTPgammaS - ATTO-655	50	1714-Eur	Jena Bio
NU-805-740	Nucleic acids: N6-(6-Amino)hexyl-ATP - ATTO-740	80	746-Eur	Jena Bio
NU-805-725	Nucleic acids: N6-(6-Amino)hexyl-ATP - ATTO-725	80	746-Eur	Jena Bio
NU-805-700	Nucleic acids: N6-(6-Amino)hexyl-ATP - ATTO-700	80	746-Eur	Jena Bio
NU-805-680	Nucleic acids: N6-(6-Amino)hexyl-ATP - ATTO-680	80	746-Eur	Jena Bio
NU-805-665	Nucleic acids: N6-(6-Amino)hexyl-ATP - ATTO-665	800	746-Eur	Jena Bio
NU-805-661Q	Nucleic acids: N6-(6-Amino)hexyl-ATP - DYQ-661	80	746-Eur	Jena Bio
NU-805-465	Nucleic acids: N6-(6-Amino)hexyl-ATP - ATTO-465	120	746-Eur	Jena Bio
NU-810-633	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - ATTO-633	40	746-Eur	Jena Bio
NU-810-740	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - ATTO-740	40	746-Eur	Jena Bio
NU-1610-590	Nucleic acids: EDA-GTPgammaS - ATTO-590	50	1714-Eur	Jena Bio
NU-810-495	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - ATTO-495	40	746-Eur	Jena Bio
NU-810-488	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - ATTO-488	20	209-Eur	Jena Bio
NU-1610-565	Nucleic acids: EDA-GTPgammaS - ATTO-565	50	1714-Eur	Jena Bio
NU-810-MB2	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - ATTO-MB2	40	746-Eur	Jena Bio
NU-810-MNT	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - MANT	100	746-Eur	Jena Bio
NU-810-465	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - ATTO-465	80	746-Eur	Jena Bio
NU-810-425	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - ATTO-425	80	746-Eur	Jena Bio
NU-810-532	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - ATTO-532	10	209-Eur	Jena Bio
NU-810-565	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - ATTO-565	80	746-Eur	Jena Bio
NU-810-725	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - ATTO-725	40	746-Eur	Jena Bio
NU-810-655	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - ATTO-655	10	209-Eur	Jena Bio
NU-810-656	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - OYSTER-656	40	746-Eur	Jena Bio
NU-810-660Q	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - DYQ-660	40	746-Eur	Jena Bio
NU-810-661Q	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - DYQ-661	40	746-Eur	Jena Bio
NU-810-665	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - ATTO-665	400	746-Eur	Jena Bio
NU-810-680	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - ATTO-680	40	746-Eur	Jena Bio
NU-810-594	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - ATTO-594	40	746-Eur	Jena Bio
NU-810-700	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - ATTO-700	40	746-Eur	Jena Bio
NU-810-590	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - ATTO-590	80	746-Eur	Jena Bio
NU-1610-550	Nucleic acids: EDA-GTPgammaS - ATTO-550	50	1714-Eur	Jena Bio
NU-810-TAM	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - 5_6-TAMRA	30	209-Eur	Jena Bio
NU-814-CY3	Nucleic acids: gamma-[(6-Aminohexyl)imido]-ATP - Cy3	30	209-Eur	Jena Bio
NU-814-CY5	Nucleic acids: gamma-[(6-Aminohexyl)imido]-ATP - Cy5	30	209-Eur	Jena Bio
NU-809-TXR	Nucleic acids: 5-Propargylamino-dCTP - Texas Red	120	746-Eur	Jena Bio
NU-809-TAM	Nucleic acids: 5-Propargylamino-dCTP - 5_6-TAMRA	30	209-Eur	Jena Bio
NU-1610-594	Nucleic acids: EDA-GTPgammaS - ATTO-594	50	1714-Eur	Jena Bio
NU-809-MNT	Nucleic acids: 5-Propargylamino-dCTP - MANT	100	746-Eur	Jena Bio
NU-809-MB2	Nucleic acids: 5-Propargylamino-dCTP - ATTO-MB2	40	746-Eur	Jena Bio
NU-810-620	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - ATTO-620	40	746-Eur	Jena Bio
NU-809-740	Nucleic acids: 5-Propargylamino-dCTP - ATTO-740	40	746-Eur	Jena Bio
NU-1609-MNT	Nucleic acids: EDA-ATPgammaS - MANT	50	1714-Eur	Jena Bio
NU-814-5FM	Nucleic acids: gamma-[(6-Aminohexyl)imido]-ATP - 5-FAM	40	209-Eur	Jena Bio
NU-810-390	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - ATTO-390	80	746-Eur	Jena Bio
NU-810-TXR	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - Texas Red	120	746-Eur	Jena Bio
NU-1610-532	Nucleic acids: EDA-GTPgammaS - ATTO-532	50	1714-Eur	Jena Bio
NU-1610-495	Nucleic acids: EDA-GTPgammaS - ATTO-495	50	1714-Eur	Jena Bio
NU-1610-488	Nucleic acids: EDA-GTPgammaS - ATTO-488	50	1714-Eur	Jena Bio
NU-1610-465	Nucleic acids: EDA-GTPgammaS - ATTO-465	50	1714-Eur	Jena Bio
NU-1610-425	Nucleic acids: EDA-GTPgammaS - ATTO-425	50	1714-Eur	Jena Bio
NU-1610-390	Nucleic acids: EDA-GTPgammaS - ATTO-390	50	1714-Eur	Jena Bio
NU-1609-TXR	Nucleic acids: EDA-ATPgammaS - Texas Red	50	1714-Eur	Jena Bio
NU-1609-TAM	Nucleic acids: EDA-ATPgammaS - 5_6-TAMRA	50	1714-Eur	Jena Bio
NU-809-725	Nucleic acids: 5-Propargylamino-dCTP - ATTO-725	40	746-Eur	Jena Bio
NU-805-425	Nucleic acids: N6-(6-Amino)hexyl-ATP - ATTO-425	120	746-Eur	Jena Bio
NU-528S	Nucleic acids: AP4U, S pack	150Units	133-Eur	Jena Bio
NU-506S	Nucleic acids: AP3A, S pack	50Units	128-Eur	Jena Bio
NU-506L	Nucleic acids: AP3A, L pack	250Units	316-Eur	Jena Bio
NU-827L	Nucleic acids: EDA-m7GDP, L pack	300	316-Eur	Jena Bio
NU-505S	Nucleic acids: AP5U, S pack	50Units	128-Eur	Jena Bio
NU-505L	Nucleic acids: AP5U, L pack	250Units	316-Eur	Jena Bio
NU-504S	Nucleic acids: AP5G, S pack	50Units	128-Eur	Jena Bio
NU-827S	Nucleic acids: EDA-m7GDP, S pack	60	128-Eur	Jena Bio
NU-504L	Nucleic acids: AP5G, L pack	250Units	316-Eur	Jena Bio
NU-503S	Nucleic acids: AP4G, S pack	50Units	128-Eur	Jena Bio
NU-507L	Nucleic acids: AP4A, L pack	500Units	316-Eur	Jena Bio
NU-827-BIO	Nucleic acids: EDA-m7GDP - Biotin, pack	50	172-Eur	Jena Bio
NU-507S	Nucleic acids: AP4A, S pack	100Units	128-Eur	Jena Bio
NU-528L	Nucleic acids: AP4U, L pack	750Units	331-Eur	Jena Bio
NU-810-550	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - ATTO-550	40	746-Eur	Jena Bio
NU-1610-680	Nucleic acids: EDA-GTPgammaS - ATTO-680	50	1714-Eur	Jena Bio
NU-512S	Nucleic acids: m7GP3C, S pack	50Units	128-Eur	Jena Bio
NU-512L	Nucleic acids: m7GP3C, L pack	250Units	316-Eur	Jena Bio
NU-509S	Nucleic acids: AP6A, S pack	20Units	128-Eur	Jena Bio
NU-509L	Nucleic acids: AP6A, L pack	100Units	316-Eur	Jena Bio
NU-508S	Nucleic acids: AP5A, S pack	50Units	133-Eur	Jena Bio
NU-508L	Nucleic acids: AP5A, L pack	250Units	331-Eur	Jena Bio
NU-503L	Nucleic acids: AP4G, L pack	250Units	316-Eur	Jena Bio
NU-502S	Nucleic acids: AP5dT, S pack	50Units	128-Eur	Jena Bio
NU-1610-TAM	Nucleic acids: EDA-GTPgammaS - 5_6-TAMRA	50	1714-Eur	Jena Bio
NU-1610-TXR	Nucleic acids: EDA-GTPgammaS - Texas Red	50	1714-Eur	Jena Bio
NU-426S	Nucleic acids: dATPalphaS, S pack	100Units	133-Eur	Jena Bio
NU-426L	Nucleic acids: dATPalphaS, L pack	500Units	331-Eur	Jena Bio
NU-425S	Nucleic acids: dCTPalphaS, S pack	100Units	128-Eur	Jena Bio
NU-425L	Nucleic acids: dCTPalphaS, L pack	500Units	316-Eur	Jena Bio
NU-831L	Nucleic acids: 5-Propargylamino-CTP, L pack	150Units	316-Eur	Jena Bio
NU-424S	Nucleic acids: dGTPalphaS, S pack	100Units	128-Eur	Jena Bio
NU-424L	Nucleic acids: dGTPalphaS, L pack	500Units	316-Eur	Jena Bio
NU-1610-MNT	Nucleic acids: EDA-GTPgammaS - MANT	50	1714-Eur	Jena Bio
E0738Ra	Rat free fatty acids,FFA ELISA Kit	48T	379-Eur	Eastbio	Elisa kits
NU-436S	Nucleic acids: CTPalphaS, S pack	25	128-Eur	Jena Bio
NU-502L	Nucleic acids: AP5dT, L pack	250Units	316-Eur	Jena Bio
NU-501S	Nucleic acids: AP4dT, S pack	50Units	128-Eur	Jena Bio
NU-501L	Nucleic acids: AP4dT, L pack	250Units	316-Eur	Jena Bio
NU-443-1	Nucleic acids: dApNHpp, 1 mg pack (dAMPNPP)	1mg	300-Eur	Jena Bio
NU-1610-700	Nucleic acids: EDA-GTPgammaS - ATTO-700	50	1714-Eur	Jena Bio
NU-440-1	Nucleic acids: dGpNHpp, 1 mg pack (dGMPNPP)	1mg	300-Eur	Jena Bio
NU-439-1	Nucleic acids: dCpNHpp, 1 mg pack (dCMPNPP)	1mg	300-Eur	Jena Bio
NU-1610-725	Nucleic acids: EDA-GTPgammaS - ATTO-725	50	1714-Eur	Jena Bio
NU-1610-740	Nucleic acids: EDA-GTPgammaS - ATTO-740	50	1714-Eur	Jena Bio
NU-422-25	Nucleic acids: AppCp, 25 mg pack (AMPPCP)	25mg	117-Eur	Jena Bio
NU-805-390	Nucleic acids: N6-(6-Amino)hexyl-ATP - ATTO-390	120	746-Eur	Jena Bio
NU-803-700	Nucleic acids: Aminoallyl-dUTP - ATTO-700	40	746-Eur	Jena Bio
NU-803-680	Nucleic acids: Aminoallyl-dUTP - ATTO-680	10	209-Eur	Jena Bio
NU-803-665	Nucleic acids: Aminoallyl-dUTP - ATTO-665	400	746-Eur	Jena Bio
NU-803-661Q	Nucleic acids: Aminoallyl-dUTP - DYQ-661	40	746-Eur	Jena Bio
NU-803-660Q	Nucleic acids: Aminoallyl-dUTP - DYQ-660	40	746-Eur	Jena Bio
NU-803-656	Nucleic acids: Aminoallyl-dUTP - OYSTER-656	40	746-Eur	Jena Bio
NU-803-655	Nucleic acids: Aminoallyl-dUTP - ATTO-655	10	209-Eur	Jena Bio
NU-803-633	Nucleic acids: Aminoallyl-dUTP - ATTO-633	40	746-Eur	Jena Bio
NU-803-620	Nucleic acids: Aminoallyl-dUTP - ATTO-620	40	746-Eur	Jena Bio
NU-803-725	Nucleic acids: Aminoallyl-dUTP - ATTO-725	40	746-Eur	Jena Bio
NU-803-740	Nucleic acids: Aminoallyl-dUTP - ATTO-740	80	746-Eur	Jena Bio
NU-803-DIGXL	Nucleic acids: DIG-11-dUTP, L pack	125	331-Eur	Jena Bio
NU-1610-656	Nucleic acids: EDA-GTPgammaS - OYSTER-656	50	1714-Eur	Jena Bio
NU-1610-660Q	Nucleic acids: EDA-GTPgammaS - DYQ-660	50	1714-Eur	Jena Bio
NU-803-TXR	Nucleic acids: Aminoallyl-dUTP - Texas Red	30	209-Eur	Jena Bio
NU-803-TAM	Nucleic acids: Aminoallyl-dUTP - 5_6-TAMRA	30	209-Eur	Jena Bio
NU-1610-661Q	Nucleic acids: EDA-GTPgammaS - DYQ-661	50	1714-Eur	Jena Bio
NU-803-MNT	Nucleic acids: Aminoallyl-dUTP - MANT	100	746-Eur	Jena Bio
NU-803-MB2	Nucleic acids: Aminoallyl-dUTP - ATTO-MB2	40	746-Eur	Jena Bio
NU-1610-665	Nucleic acids: EDA-GTPgammaS - ATTO-665	500	1714-Eur	Jena Bio
NU-803-DIGXS	Nucleic acids: DIG-11-dUTP, S pack	25	133-Eur	Jena Bio
NU-803-594	Nucleic acids: Aminoallyl-dUTP - ATTO-594	40	746-Eur	Jena Bio
NU-803-590	Nucleic acids: Aminoallyl-dUTP - ATTO-590	20	209-Eur	Jena Bio
NU-801-3	Nucleic acids: gamma-Aminophenyl-ATP, 3 mg pack	3mg	128-Eur	Jena Bio
NU-801-15	Nucleic acids: gamma-Aminophenyl-ATP, 15 mg pack	15mg	316-Eur	Jena Bio
NU-824L	Nucleic acids: EDA-m7GTP, L pack	150Units	316-Eur	Jena Bio
NU-824S	Nucleic acids: EDA-m7GTP, S pack	30Units	128-Eur	Jena Bio
NU-533S	Nucleic acids: GP4G, S pack	20Units	128-Eur	Jena Bio
NU-533L	Nucleic acids: GP4G, L pack	100Units	316-Eur	Jena Bio
NU-532S	Nucleic acids: m7GP5G, S pack	20Units	128-Eur	Jena Bio
NU-532L	Nucleic acids: m7GP5G, L pack	100Units	316-Eur	Jena Bio
NU-531S	Nucleic acids: GP2G, S pack	20Units	128-Eur	Jena Bio
NU-824-BIO	Nucleic acids: EDA-m7GTP - Biotin, pack	50	172-Eur	Jena Bio
NU-421-2	Nucleic acids: ApCpp, 2 mg pack (AMPCPP)	2mg	92-Eur	Jena Bio
NU-803-1	Nucleic acids: Aminoallyl-dUTP, 1 mg pack	1mg	116-Eur	Jena Bio
NU-803-565	Nucleic acids: Aminoallyl-dUTP - ATTO-565	20	209-Eur	Jena Bio
NU-803-550	Nucleic acids: Aminoallyl-dUTP - ATTO-550	20	209-Eur	Jena Bio
NU-803-532	Nucleic acids: Aminoallyl-dUTP - ATTO-532	20	209-Eur	Jena Bio
NU-803-5	Nucleic acids: Aminoallyl-dUTP, 5 mg pack	5mg	411-Eur	Jena Bio
NU-803-495	Nucleic acids: Aminoallyl-dUTP - ATTO-495	20	209-Eur	Jena Bio
NU-803-488	Nucleic acids: Aminoallyl-dUTP - ATTO-488	20	209-Eur	Jena Bio
NU-803-465	Nucleic acids: Aminoallyl-dUTP - ATTO-465	80	746-Eur	Jena Bio
NU-803-425	Nucleic acids: Aminoallyl-dUTP - ATTO-425	20	209-Eur	Jena Bio
NU-803-390	Nucleic acids: Aminoallyl-dUTP - ATTO-390	80	746-Eur	Jena Bio
NU-531L	Nucleic acids: GP2G, L pack	100Units	316-Eur	Jena Bio
S015-100GM	Amino Acids,L-Serine	100G	75-Eur	Caisson Laboratory
PEPT184	Regular Peptide of 5-30 amino acids>85%	50-59 mg	70-Eur	British Biocelle
PEPT281	Regular Peptide of 5-30 amino acids>98%	1-4 mg	67-Eur	British Biocelle
PEPT154	Regular Peptide of 31-40 amino acids>80%	5-9 mg	67-Eur	British Biocelle
PEPT130	Regular Peptide of 41-50 amino acids>75%	5-9 mg	67-Eur	British Biocelle
PEPT097	Regular Peptide of 41-50 amino acids>70%	15-19 mg	67-Eur	British Biocelle
PEPT182	Regular Peptide of 5-30 amino acids>85%	30-39 mg	67-Eur	British Biocelle
PEPT087	Regular Peptide of 31-40 amino acids>70%	20-24 mg	67-Eur	British Biocelle
PEPT214	Regular Peptide of 5-30 amino acids>90%	15-19 mg	66-Eur	British Biocelle
PEPT181	Regular Peptide of 5-30 amino acids>85%	25-29 mg	66-Eur	British Biocelle
PEPT120	Regular Peptide of 31-40 amino acids>75%	10-14 mg	68-Eur	British Biocelle
PEPT082	Regular Peptide of 5-30 amino acids>70%	100mg	68-Eur	British Biocelle
PEPT215	Regular Peptide of 5-30 amino acids>90%	20-24 mg	68-Eur	British Biocelle
PEPT098	Regular Peptide of 41-50 amino acids>70%	20-24 mg	70-Eur	British Biocelle
PEPT089	Regular Peptide of 31-40 amino acids>70%	30-39 mg	69-Eur	British Biocelle
PEPT216	Regular Peptide of 5-30 amino acids>90%	25-29 mg	69-Eur	British Biocelle
PEPT121	Regular Peptide of 31-40 amino acids>75%	15-19 mg	69-Eur	British Biocelle
PEPT183	Regular Peptide of 5-30 amino acids>85%	40-49 mg	68-Eur	British Biocelle
PEPT115	Regular Peptide of 5-30 amino acids>75%	60-79 mg	68-Eur	British Biocelle
PEPT088	Regular Peptide of 31-40 amino acids>70%	25-29 mg	68-Eur	British Biocelle
PEPT249	Regular Peptide of 5-30 amino acids>95%	15-19 mg	68-Eur	British Biocelle
PEPT148	Regular Peptide of 5-30 amino acids>80%	40-49 mg	66-Eur	British Biocelle
PEPT081	Regular Peptide of 5-30 amino acids>70%	80mg	66-Eur	British Biocelle
PEPT096	Regular Peptide of 41-50 amino acids>70%	10-14 mg	66-Eur	British Biocelle
PEPT179	Regular Peptide of 5-30 amino acids>85%	15-19 mg	64-Eur	British Biocelle
PEPT112	Regular Peptide of 5-30 amino acids>75%	30-39 mg	64-Eur	British Biocelle
PEPT247	Regular Peptide of 5-30 amino acids>95%	5-9 mg	64-Eur	British Biocelle
PEPT145	Regular Peptide of 5-30 amino acids>80%	20-24 mg	64-Eur	British Biocelle
PEPT079	Regular Peptide of 5-30 amino acids>70%	50-59 mg	63-Eur	British Biocelle
PEPT212	Regular Peptide of 5-30 amino acids>90%	5-9 mg	63-Eur	British Biocelle
PEPT111	Regular Peptide of 5-30 amino acids>75%	25-29 mg	63-Eur	British Biocelle
PEPT178	Regular Peptide of 5-30 amino acids>85%	10-14 mg	62-Eur	British Biocelle
PEPT095	Regular Peptide of 41-50 amino acids>70%	5-9 mg	64-Eur	British Biocelle
PEPT085	Regular Peptide of 31-40 amino acids>70%	10-14 mg	64-Eur	British Biocelle
PEPT113	Regular Peptide of 5-30 amino acids>75%	40-49 mg	64-Eur	British Biocelle
PEPT248	Regular Peptide of 5-30 amino acids>95%	10-14 mg	66-Eur	British Biocelle
PEPT114	Regular Peptide of 5-30 amino acids>75%	50-59 mg	66-Eur	British Biocelle
PEPT180	Regular Peptide of 5-30 amino acids>85%	20-24 mg	65-Eur	British Biocelle
PEPT119	Regular Peptide of 31-40 amino acids>75%	5-9 mg	65-Eur	British Biocelle
PEPT086	Regular Peptide of 31-40 amino acids>70%	15-19 mg	65-Eur	British Biocelle
PEPT213	Regular Peptide of 5-30 amino acids>90%	10-14 mg	65-Eur	British Biocelle
PEPT146	Regular Peptide of 5-30 amino acids>80%	25-29 mg	65-Eur	British Biocelle
PEPT080	Regular Peptide of 5-30 amino acids>70%	60-79 mg	65-Eur	British Biocelle
PEPT084	Regular Peptide of 31-40 amino acids>70%	5-9 mgx5	108-Eur	British Biocelle
PEPT167	Regular Peptide of 41-50 amino acids>80%	15-19 mg	76-Eur	British Biocelle
PEPT166	Regular Peptide of 41-50 amino acids>80%	10-14 mg	74-Eur	British Biocelle
18-003-44179	NOVA2 [amino acids 1-28] - N_A Polyclonal	0.1 mg Protein A	325-Eur	GenWay	polyclonal
18-003-44180	NOVA2 [amino acids 1-28] - N_A Polyclonal	0.1 mg Protein A	325-Eur	GenWay	polyclonal
PEPT259	Regular Peptide of 31-40 amino acids>95%	5-9 mg	74-Eur	British Biocelle
PEPT190	Regular Peptide of 31-40 amino acids>85%	10-14 mg	74-Eur	British Biocelle
PEPT101	Regular Peptide of 41-50 amino acids>70%	40-49 mg	74-Eur	British Biocelle
PEPT252	Regular Peptide of 5-30 amino acids>95%	30-39 mg	73-Eur	British Biocelle
PEPT219	Regular Peptide of 5-30 amino acids>90%	50-59 mg	73-Eur	British Biocelle
PEPT283	Regular Peptide of 5-30 amino acids>98%	10-14 mg	74-Eur	British Biocelle
PEPT123	Regular Peptide of 31-40 amino acids>75%	25-29 mg	74-Eur	British Biocelle
PEPT186	Regular Peptide of 5-30 amino acids>85%	80mg	74-Eur	British Biocelle
PEPT102	Regular Peptide of 41-50 amino acids>70%	50-59 mg	76-Eur	British Biocelle
PEPT133	Regular Peptide of 41-50 amino acids>75%	20-24 mg	76-Eur	British Biocelle
PEPT225	Regular Peptide of 31-40 amino acids>90%	10-14 mg	76-Eur	British Biocelle
PEPT157	Regular Peptide of 31-40 amino acids>80%	20-24 mg	76-Eur	British Biocelle
PEPT235	Regular Peptide of 41-50 amino acids>90%	5-9 mg	75-Eur	British Biocelle
PEPT253	Regular Peptide of 5-30 amino acids>95%	40-49 mg	75-Eur	British Biocelle
10-002-38009	DnaJ (amino acids 1-376) - Hsp40 N_A	1 mg	1103-Eur	GenWay	dna
PEPT152	Regular Peptide of 5-30 amino acids>80%	100mg	75-Eur	British Biocelle
PEPT200	Regular Peptide of 41-50 amino acids>85%	5-9 mg	73-Eur	British Biocelle
PEPT100	Regular Peptide of 41-50 amino acids>70%	30-39 mg	73-Eur	British Biocelle
PEPT156	Regular Peptide of 31-40 amino acids>80%	15-19 mg	72-Eur	British Biocelle
PEPT155	Regular Peptide of 31-40 amino acids>80%	10-14 mg	71-Eur	British Biocelle
PEPT282	Regular Peptide of 5-30 amino acids>98%	5-9 mg	70-Eur	British Biocelle
PEPT131	Regular Peptide of 41-50 amino acids>75%	10-14 mg	70-Eur	British Biocelle
PEPT250	Regular Peptide of 5-30 amino acids>95%	20-24 mg	70-Eur	British Biocelle
PEPT150	Regular Peptide of 5-30 amino acids>80%	60-79 mg	70-Eur	British Biocelle
PEPT116	Regular Peptide of 5-30 amino acids>75%	80mg	70-Eur	British Biocelle
PEPT090	Regular Peptide of 31-40 amino acids>70%	40-49 mg	70-Eur	British Biocelle
PEPT165	Regular Peptide of 41-50 amino acids>80%	5-9 mg	70-Eur	British Biocelle
PEPT217	Regular Peptide of 5-30 amino acids>90%	30-39 mg	71-Eur	British Biocelle
PEPT099	Regular Peptide of 41-50 amino acids>70%	25-29 mg	71-Eur	British Biocelle
PEPT218	Regular Peptide of 5-30 amino acids>90%	40-49 mg	72-Eur	British Biocelle
PEPT091	Regular Peptide of 31-40 amino acids>70%	50-59 mg	72-Eur	British Biocelle
PEPT151	Regular Peptide of 5-30 amino acids>80%	80mg	72-Eur	British Biocelle
PEPT117	Regular Peptide of 5-30 amino acids>75%	100mg	72-Eur	British Biocelle
PEPT122	Regular Peptide of 31-40 amino acids>75%	20-24 mg	72-Eur	British Biocelle
PEPT251	Regular Peptide of 5-30 amino acids>95%	25-29 mg	72-Eur	British Biocelle
PEPT185	Regular Peptide of 5-30 amino acids>85%	60-79 mg	72-Eur	British Biocelle
PEPT132	Regular Peptide of 41-50 amino acids>75%	15-19 mg	72-Eur	British Biocelle
PEPT224	Regular Peptide of 31-40 amino acids>90%	5-9 mg	72-Eur	British Biocelle
PEPT189	Regular Peptide of 31-40 amino acids>85%	5-9 mg	70-Eur	British Biocelle
E08E0166	Canine Epoxyeicosatrienoic acids ELISA	96T/kit	708-Eur	Blue Gene Biotech	Elisa kits
NU-1017S	Nucleic acids: ddGTP, S pack 10 mM	100	63-Eur	Jena Bio
NU-1018L	Nucleic acids: ddTTP, L pack 10 mM	500	177-Eur	Jena Bio
E0795Ra	Rat free KXtty acids,FKX ELISA KIT	48T	386-Eur	JING	Elisa kits
E0737Ra	Rat free fatty acids,FFA ELISA Kit	48T	386-Eur	JING	Elisa kits
CK-E98243	Rat free fatty acids,FFA ELISAkit		----Eur	Glory	Elisa kits
N-20339-250	Nucleic acids: Isoguanosine, 250 mg pack	250mg	352-Eur	Jena Bio
CK-E97081	Human lipoteichoic acids,LTA ELISAkit		----Eur	Glory	Elisa kits
N-20339-1G	Nucleic acids: Isoguanosine, 1 g pack	1g	769-Eur	Jena Bio
NU-1017L	Nucleic acids: ddGTP, L pack 10 mM	500	177-Eur	Jena Bio
YHB1895Hu	Human lipoteichoic acids,LTA ELISA Kit	48T	347-Eur	yehua	Elisa kits
YHB0446Ra	Rat free fatty acids,FFA ELISA Kit	48T	373-Eur	yehua	Elisa kits
NU-1015S	Nucleic acids: ddATP, S pack 10 mM	100	63-Eur	Jena Bio
E11E0166	Bovine Epoxyeicosatrienoic acids ELISA	96T/kit	717-Eur	Blue Gene Biotech	Elisa kits
YHB0447Ra	Rat free KXtty acids,FKX ELISA KIT	96T	633-Eur	yehua	Elisa kits
YHB0446Ra	Rat free fatty acids,FFA ELISA Kit	96T	633-Eur	yehua	Elisa kits
YHB1895Hu	Human lipoteichoic acids,LTA ELISA Kit	96T	552-Eur	yehua	Elisa kits
NU-1016L	Nucleic acids: ddCTP, L pack 10 mM	500	177-Eur	Jena Bio
NU-1016S	Nucleic acids: ddCTP, S pack 10 mM	100	63-Eur	Jena Bio
YHB0447Ra	Rat free KXtty acids,FKX ELISA KIT	48T	373-Eur	yehua	Elisa kits
N-20339-10G	Nucleic acids: Isoguanosine, 10 g pack	10g	4958-Eur	Jena Bio
QY-E10906	Rat free fatty acids(FFA)ELISA Kit	96T	464-Eur	SQBIO	Elisa kits
QY-E10848	Rat free KXtty acids(FKX)ELISA Kit	96T	464-Eur	SQBIO	Elisa kits
NU-1022L	Nucleic acids: ddUDP, L pack	250Units	316-Eur	Jena Bio
NU-1022S	Nucleic acids: ddUDP, S pack	50Units	128-Eur	Jena Bio
NU-10405-20	Nucleic acids: 2'F-dNTP Bundle, 4x5	4 x 5	324-Eur	Jena Bio
NU-10507-04-20	Nucleic acids: 2'F-ara-dNTP Bundle, 4x5	4 x 5	788-Eur	Jena Bio
NU-10701-10	Nucleic acids: 2F_2'F-dATP, 10	10	362-Eur	Jena Bio
E02U0003	Rat w-3 unsaturated fatty acids ELISA , w-3 UFA	97 Tests/kit	601-Eur	BGene	Elisa kits
E02E0166	Rat Epoxyeicosatrienoic acids ELISA, EETs	96 Tests/kit	601-Eur	BGene	Elisa kits
NU-1101L	Nucleic acids: N6-Methyl-ATP, L pack	750Units	316-Eur	Jena Bio
NU-1021S	Nucleic acids: ddUTP, S pack	100Units	128-Eur	Jena Bio
CSB-EQ027300DO	Dog free fatty acids(FFA) ELISA kit	96T	710-Eur	Cusabio	Elisa kits
QY-E00228	Human lipoteichoic acids(LTA)ELISA Kit	96T	464-Eur	SQBIO	Elisa kits
201-11-0797	Rat free KXtty acids(FKX)ELISA Kit	96T	620-Eur	SunBT	Elisa kits
201-11-0739	Rat free fatty acids(FFA)ELISA Kit	96T	620-Eur	SunBT	Elisa kits
201-12-1911	Human lipoteichoic acids(LTA)ELISA Kit	96T	602-Eur	SunBT	Elisa kits
CK-E30208	Rat free fatty acids,FFA ELISA Kit	96T	454-Eur	Eastbio	Elisa kits
NU-1018S	Nucleic acids: ddTTP, S pack 10 mM	100	63-Eur	Jena Bio
CK-E11275	Human lipoteichoic acids,LTA ELISA Kit	96T	728-Eur	Eastbio	Elisa kits
PEPT147	Regular Peptide of 5-30 amino acids>80%	30-39 mg	66-Eur	British Biocelle
NU-1021L	Nucleic acids: ddUTP, L pack	500Units	316-Eur	Jena Bio
NU-1101S	Nucleic acids: N6-Methyl-ATP, S pack	150Units	128-Eur	Jena Bio
PEPT144	Regular Peptide of 5-30 amino acids>80%	15-19 mgx5	108-Eur	British Biocelle
PEPT108	Regular Peptide of 5-30 amino acids>75%	10-14 mgx5	96-Eur	British Biocelle
PEPT176	Regular Peptide of 5-30 amino acids>85%	1-4 mgx5	96-Eur	British Biocelle
PEPT141	Regular Peptide of 5-30 amino acids>80%	1-4 mg	89-Eur	British Biocelle
PEPT107	Regular Peptide of 5-30 amino acids>75%	5-9 mg	89-Eur	British Biocelle
PEPT074	Regular Peptide of 5-30 amino acids>70%	15-19 mg	89-Eur	British Biocelle
PEPT073	Regular Peptide of 5-30 amino acids>70%	10-14 mg	89-Eur	British Biocelle
PEPT106	Regular Peptide of 5-30 amino acids>75%	1-4 mgx5	82-Eur	British Biocelle
PEPT072	Regular Peptide of 5-30 amino acids>70%	5-9 mgx5	82-Eur	British Biocelle
PEPT142	Regular Peptide of 5-30 amino acids>80%	5-9 mgx5	96-Eur	British Biocelle
PEPT075	Regular Peptide of 5-30 amino acids>70%	20-24 mgx5	96-Eur	British Biocelle
PEPT109	Regular Peptide of 5-30 amino acids>75%	15-19 mgx5	102-Eur	British Biocelle
PEPT110	Regular Peptide of 5-30 amino acids>75%	20-24 mgx5	108-Eur	British Biocelle
PEPT246	Regular Peptide of 5-30 amino acids>95%	1-4 mgx5	108-Eur	British Biocelle
PEPT078	Regular Peptide of 5-30 amino acids>70%	40-49 mgx5	108-Eur	British Biocelle
PEPT143	Regular Peptide of 5-30 amino acids>80%	10-14 mgx5	102-Eur	British Biocelle
PEPT077	Regular Peptide of 5-30 amino acids>70%	30-39 mgx5	102-Eur	British Biocelle
PEPT211	Regular Peptide of 5-30 amino acids>90%	1-4 mgx5	102-Eur	British Biocelle
PEPT177	Regular Peptide of 5-30 amino acids>85%	5-9 mgx5	102-Eur	British Biocelle
PEPT076	Regular Peptide of 5-30 amino acids>70%	25-29 mgx5	102-Eur	British Biocelle
PEPT071	Regular Peptide of 5-30 amino acids>70%	1-4 mgx5	76-Eur	British Biocelle
23797	Rat free fatty acids(FFA) ELISA Kit	96T	878-Eur	Bio-Medical	elisa
E14E0166	Sheep Epoxyeicosatrienoic acids ELISA	96T/kit	717-Eur	Blue Gene Biotech	Elisa kits
NU-1013-10G	Nucleic acids: UTP - lyophilized, 10 g pack	10g	603-Eur	Jena Bio
E01E0166	Human Epoxyeicosatrienoic acids ELISA	96T/kit	692-Eur	Blue Gene Biotech	Elisa kits
NU-1013-1G	Nucleic acids: UTP - lyophilized, 1 g pack	1g	197-Eur	Jena Bio
E05E0166	Guinea Pig Epoxyeicosatrienoic acids ELISA	96T/kit	708-Eur	Blue Gene Biotech	Elisa kits
NU-1014L	Nucleic acids: NTP bundle, L pack 4x 100 mM (ATP, CTP, GTP, UTP)	4 x 1ml	103-Eur	Jena Bio
E06E0166	Goat Epoxyeicosatrienoic acids ELISA	96T/kit	708-Eur	Blue Gene Biotech	Elisa kits
NU-1014S	Nucleic acids: NTP bundle, S pack 4x 100 mM (ATP, CTP, GTP, UTP)	4 x 200	48-Eur	Jena Bio
E12E0166	Chicken Epoxyeicosatrienoic acids ELISA	96T/kit	717-Eur	Blue Gene Biotech	Elisa kits
SL1085Hu	Human lipoteichoic acids,LTA ELISA Kit	96T	531-Eur	Sunlog	Elisa kits
E09E0166	Monkey Epoxyeicosatrienoic acids ELISA	96T/kit	717-Eur	Blue Gene Biotech	Elisa kits
NU-1013-100	Nucleic acids: UTP - lyophilized, 100 mg pack	100mg	63-Eur	Jena Bio
E02U0003	Rat w-3 unsaturated fatty acids ELISA	96T/kit	692-Eur	Blue Gene Biotech	Elisa kits
SL0291Ra	Rat free fatty acids,FFA ELISA Kit	96T	573-Eur	Sunlog	Elisa kits
E04E0166	Rabbit Epoxyeicosatrienoic acids ELISA	96T/kit	692-Eur	Blue Gene Biotech	Elisa kits
NU-1012-10G	Nucleic acids: GTP - lyophilized, 10 g pack	10g	603-Eur	Jena Bio
E07E0166	Porcine Epoxyeicosatrienoic acids ELISA	96T/kit	708-Eur	Blue Gene Biotech	Elisa kits
NU-1012-1G	Nucleic acids: GTP - lyophilized, 1 g pack	1g	221-Eur	Jena Bio
NU-1013	Nucleic acids: UTP - solution, pack 100 mM	1ml	54-Eur	Jena Bio
E03E0166	Mouse Epoxyeicosatrienoic acids ELISA	96T/kit	692-Eur	Blue Gene Biotech	Elisa kits
NU-1015L	Nucleic acids: ddATP, L pack 10 mM	500	177-Eur	Jena Bio
PEPT092	Regular Peptide of 31-40 amino acids>70%	60-79 mg	76-Eur	British Biocelle
PEPT209	Regular Peptide of 41-50 amino acids>85%	80-100 mg	109-Eur	British Biocelle
FC3-003-22	Nesfatin_1 (Rat) (82 amino acids) _ Cy3 Labeled _ 1 nmol	1 nmol	833-Eur	Phoenix Peptide	labeled
FC5-003-22	Nesfatin_1 (Rat) (82 amino acids) _ Cy5 Labeled _ 1 nmol	1 nmol	833-Eur	Phoenix Peptide	labeled
FG-003-22A	Nesfatin_1 (Rat) (82 amino acids) _ FAM Labeled _ 1 nmol	1 nmol	692-Eur	Phoenix Peptide	labeled
NU-1010-10G	Nucleic acids: ATP - lyophilized, 10 g pack	10g	97-Eur	Jena Bio
NU-1011	Nucleic acids: CTP - solution, pack 100 mM	1ml	54-Eur	Jena Bio
PEPT243	Regular Peptide of 41-50 amino acids>90%	60-79 mg	104-Eur	British Biocelle
PEPT292	Regular Peptide of 5-30 amino acids>98%	100mg	104-Eur	British Biocelle
PEPT083	Regular Peptide of 5-30 amino acids>70%	1000 mg	104-Eur	British Biocelle
PEPT277	Regular Peptide of 41-50 amino acids>95%	50-59 mg	104-Eur	British Biocelle
077-72A	short_chain fatty acids (Acetate, C2) solution _ 5mg	5 mg	111-Eur	Phoenix Peptide
077-68	short_chain fatty acids (ButyRe, C4) _ 200ug	200 µg	126-Eur	Phoenix Peptide
PEPT298	Regular Peptide of 31-40 amino acids>98%	25-29 mg	107-Eur	British Biocelle
PEPT233	Regular Peptide of 31-40 amino acids>90%	80-100 mg	105-Eur	British Biocelle
PEPT174	Regular Peptide of 41-50 amino acids>80%	80-100 mg	104-Eur	British Biocelle
PEPT307	Regular Peptide of 41-50 amino acids>98%	15-19 mg	104-Eur	British Biocelle
CSB-E08770r	Rat free fatty acids,FFA ELISA Kit	96tests	915-Eur	Cusabio	elisa
CSB-E09628h	Human lipoteichoic acids,LTA ELISA Kit	96tests	856-Eur	Cusabio	elisa
003-26	Nesfatin_1 (Human) (82 amino acids) _ 20ug	20 µg	284-Eur	Phoenix Peptide	human
003-26B	Nesfatin_1 (Human) (82 amino acids) _ 100ug	100 µg	579-Eur	Phoenix Peptide	human
PEPT297	Regular Peptide of 31-40 amino acids>98%	20-24 mg	103-Eur	British Biocelle
PEPT267	Regular Peptide of 31-40 amino acids>95%	60-79 mg	102-Eur	British Biocelle
PEPT198	Regular Peptide of 31-40 amino acids>85%	80-100 mg	101-Eur	British Biocelle
PEPT232	Regular Peptide of 31-40 amino acids>90%	60-79 mg	96-Eur	British Biocelle
PEPT173	Regular Peptide of 41-50 amino acids>80%	60-79 mg	96-Eur	British Biocelle
PEPT274	Regular Peptide of 41-50 amino acids>95%	25-29 mg	94-Eur	British Biocelle
PEPT290	Regular Peptide of 5-30 amino acids>98%	60-79 mg	94-Eur	British Biocelle
PEPT207	Regular Peptide of 41-50 amino acids>85%	50-59 mg	94-Eur	British Biocelle
PEPT241	Regular Peptide of 41-50 amino acids>90%	40-49 mg	94-Eur	British Biocelle
PEPT265	Regular Peptide of 31-40 amino acids>95%	40-49 mg	93-Eur	British Biocelle
NU-1011-100	Nucleic acids: CTP - lyophilized, 100 mg pack	100mg	63-Eur	Jena Bio
PEPT266	Regular Peptide of 31-40 amino acids>95%	50-59 mg	96-Eur	British Biocelle
TM 499	YEAST NITROGEN BASE W_O. AMINO ACIDS (Sto	100 gm	105-Eur	TitanBiotech	yeast
PEPT296	Regular Peptide of 31-40 amino acids>98%	15-19 mg	96-Eur	British Biocelle
PEPT276	Regular Peptide of 41-50 amino acids>95%	40-49 mg	100-Eur	British Biocelle
PEPT208	Regular Peptide of 41-50 amino acids>85%	60-79 mg	99-Eur	British Biocelle
PEPT139	Regular Peptide of 41-50 amino acids>75%	80-100 mg	99-Eur	British Biocelle
PEPT291	Regular Peptide of 5-30 amino acids>98%	80mg	99-Eur	British Biocelle
PEPT306	Regular Peptide of 41-50 amino acids>98%	10-14 mg	98-Eur	British Biocelle
PEPT275	Regular Peptide of 41-50 amino acids>95%	30-39 mg	97-Eur	British Biocelle
PEPT242	Regular Peptide of 41-50 amino acids>90%	50-59 mg	97-Eur	British Biocelle
PEPT163	Regular Peptide of 31-40 amino acids>80%	80-100 mg	97-Eur	British Biocelle
PEPT197	Regular Peptide of 31-40 amino acids>85%	60-79 mg	92-Eur	British Biocelle
PEPT315	Regular Peptide of 41-50 amino acids>98%	1000 mg	372-Eur	British Biocelle
PEPT129	Regular Peptide of 31-40 amino acids>75%	1000 mg	177-Eur	British Biocelle
PEPT314	Regular Peptide of 41-50 amino acids>98%	80-100 mg	158-Eur	British Biocelle
PEPT258	Regular Peptide of 5-30 amino acids>95%	1000 mg	157-Eur	British Biocelle
PEPT105	Regular Peptide of 41-50 amino acids>70%	1000 mg	156-Eur	British Biocelle
PEPT223	Regular Peptide of 5-30 amino acids>90%	1000 mg	146-Eur	British Biocelle
PEPT303	Regular Peptide of 31-40 amino acids>98%	80-100 mg	142-Eur	British Biocelle
PEPT313	Regular Peptide of 41-50 amino acids>98%	60-79 mg	142-Eur	British Biocelle
PEPT094	Regular Peptide of 31-40 amino acids>70%	1000 mg	141-Eur	British Biocelle
PEPT164	Regular Peptide of 31-40 amino acids>80%	1000 mg	189-Eur	British Biocelle
PEPT140	Regular Peptide of 41-50 amino acids>75%	1000 mg	198-Eur	British Biocelle
PEPT199	Regular Peptide of 31-40 amino acids>85%	1000 mg	202-Eur	British Biocelle
PEPT304	Regular Peptide of 31-40 amino acids>98%	1000 mg	326-Eur	British Biocelle
PEPT280	Regular Peptide of 41-50 amino acids>95%	1000 mg	265-Eur	British Biocelle
PEPT245	Regular Peptide of 41-50 amino acids>90%	1000 mg	244-Eur	British Biocelle
PEPT269	Regular Peptide of 31-40 amino acids>95%	1000 mg	234-Eur	British Biocelle
PEPT210	Regular Peptide of 41-50 amino acids>85%	1000 mg	227-Eur	British Biocelle
PEPT234	Regular Peptide of 31-40 amino acids>90%	1000 mg	216-Eur	British Biocelle
PEPT175	Regular Peptide of 41-50 amino acids>80%	1000 mg	213-Eur	British Biocelle
PEPT293	Regular Peptide of 5-30 amino acids>98%	1000 mg	210-Eur	British Biocelle
PEPT312	Regular Peptide of 41-50 amino acids>98%	50-59 mg	131-Eur	British Biocelle
PEPT188	Regular Peptide of 5-30 amino acids>85%	1000 mg	130-Eur	British Biocelle
PEPT302	Regular Peptide of 31-40 amino acids>98%	60-79 mg	128-Eur	British Biocelle
878	VERY LONG CHAIN FATTY ACIDS, SERUM	1	271-Eur	Kenova
PEPT309	Regular Peptide of 41-50 amino acids>98%	25-29 mg	117-Eur	British Biocelle
NU-1010	Nucleic acids: ATP - solution, pack 100 mM	1ml	54-Eur	Jena Bio
PEPT300	Regular Peptide of 31-40 amino acids>98%	40-49 mg	115-Eur	British Biocelle
PEPT244	Regular Peptide of 41-50 amino acids>90%	80-100 mg	115-Eur	British Biocelle
PEPT308	Regular Peptide of 41-50 amino acids>98%	20-24 mg	112-Eur	British Biocelle
PEPT268	Regular Peptide of 31-40 amino acids>95%	80-100 mg	112-Eur	British Biocelle
PEPT278	Regular Peptide of 41-50 amino acids>95%	60-79 mg	111-Eur	British Biocelle
566	FREE FATTY ACIDS (NEFA), SERUM	1	31-Eur	Kenova
2709	FRACTIONATED AMINO ACIDS, URINE	1	49-Eur	Kenova
CSB-E08770r	Rat free fatty acids,FFA ELISA Kit	96tests	856-Eur	Cusabio	elisa
PEPT311	Regular Peptide of 41-50 amino acids>98%	40-49 mg	126-Eur	British Biocelle
PEPT153	Regular Peptide of 5-30 amino acids>80%	1000 mg	124-Eur	British Biocelle
PEPT279	Regular Peptide of 41-50 amino acids>95%	80-100 mg	122-Eur	British Biocelle
PEPT310	Regular Peptide of 41-50 amino acids>98%	30-39 mg	121-Eur	British Biocelle
XC-E1152/100	MEM Amino Acids 50X w_o L_Glutamine _ 100ml		40-Eur	Biosera
PEPT301	Regular Peptide of 31-40 amino acids>98%	50-59 mg	119-Eur	British Biocelle
PEPT118	Regular Peptide of 5-30 amino acids>75%	1000 mg	117-Eur	British Biocelle
CSB-E09628h	Human lipoteichoic acids,LTA ELISA Kit	96tests	797-Eur	Cusabio	elisa
PEPT299	Regular Peptide of 31-40 amino acids>98%	30-39 mg	111-Eur	British Biocelle
PEPT193	Regular Peptide of 31-40 amino acids>85%	25-29 mg	81-Eur	British Biocelle
PEPT236	Regular Peptide of 41-50 amino acids>90%	10-14 mg	80-Eur	British Biocelle
PEPT093	Regular Peptide of 31-40 amino acids>70%	80-100 mg	80-Eur	British Biocelle
PEPT255	Regular Peptide of 5-30 amino acids>95%	60-79 mg	80-Eur	British Biocelle
NU-1011-1G	Nucleic acids: CTP - lyophilized, 1 g pack	1g	197-Eur	Jena Bio
CSB-E08770r	Rat free fatty acids,FFA ELISA Kit	96T	915-Eur	Cusabio	elisa
NU-1012	Nucleic acids: GTP - solution, pack 100 mM	1ml	54-Eur	Jena Bio
CSB-E09628h	Human lipoteichoic acids,LTA ELISA Kit	96T	856-Eur	Cusabio	elisa
NU-1012-100	Nucleic acids: GTP - lyophilized, 100 mg pack	100mg	78-Eur	Jena Bio
TM 499	YEAST NITROGEN BASE W_O. AMINO ACIDS (Sto	100 gm	105-Eur	TitanBiotech	yeast
PEPT168	Regular Peptide of 41-50 amino acids>80%	20-24 mg	80-Eur	British Biocelle
PEPT285	Regular Peptide of 5-30 amino acids>98%	20-24 mg	80-Eur	British Biocelle
PEPT261	Regular Peptide of 31-40 amino acids>95%	15-19 mg	81-Eur	British Biocelle
PEPT227	Regular Peptide of 31-40 amino acids>90%	20-24 mg	81-Eur	British Biocelle
PEPT160	Regular Peptide of 31-40 amino acids>80%	40-49 mg	81-Eur	British Biocelle
PEPT126	Regular Peptide of 31-40 amino acids>75%	50-59 mg	81-Eur	British Biocelle
PEPT202	Regular Peptide of 41-50 amino acids>85%	15-19 mg	81-Eur	British Biocelle
PEPT135	Regular Peptide of 41-50 amino acids>75%	30-39 mg	81-Eur	British Biocelle
NU-1011-10G	Nucleic acids: CTP - lyophilized, 10 g pack	10g	603-Eur	Jena Bio
PEPT103	Regular Peptide of 41-50 amino acids>70%	60-79 mg	81-Eur	British Biocelle
PEPT159	Regular Peptide of 31-40 amino acids>80%	30-39 mg	79-Eur	British Biocelle
PEPT221	Regular Peptide of 5-30 amino acids>90%	80mg	79-Eur	British Biocelle
PEPT192	Regular Peptide of 31-40 amino acids>85%	20-24 mg	79-Eur	British Biocelle
NK-111	Nucleic acids: 7-Deaza-2'-Deoxy-Adenosine Kit	1Kit	194-Eur	Jena Bio
U1405h	Human lipoteichoic acids CLIA KIT	96T	706-Eur	EIAab	assays
NK-110	Nucleic acids: 7-Deaza-2'-Deoxy-Guanosine Kit	1Kit	194-Eur	Jena Bio
PEPT254	Regular Peptide of 5-30 amino acids>95%	50-59 mg	77-Eur	British Biocelle
PEPT187	Regular Peptide of 5-30 amino acids>85%	100mg	77-Eur	British Biocelle
U0612r	Rat free fatty acids CLIA KIT	96T	755-Eur	EIAab	assays
PEPT220	Regular Peptide of 5-30 amino acids>90%	60-79 mg	76-Eur	British Biocelle
PEPT191	Regular Peptide of 31-40 amino acids>85%	15-19 mg	76-Eur	British Biocelle
E1405h	Human lipoteichoic acids ELISA Kit	96T	706-Eur	EIAab	elisa
E0612r	Rat free fatty acids ELISA Kit	96T	755-Eur	EIAab	elisa
PEPT125	Regular Peptide of 31-40 amino acids>75%	40-49 mg	77-Eur	British Biocelle
PEPT226	Regular Peptide of 31-40 amino acids>90%	15-19 mg	78-Eur	British Biocelle
PEPT134	Regular Peptide of 41-50 amino acids>75%	25-29 mg	78-Eur	British Biocelle
PEPT158	Regular Peptide of 31-40 amino acids>80%	25-29 mg	78-Eur	British Biocelle
PEPT260	Regular Peptide of 31-40 amino acids>95%	10-14 mg	78-Eur	British Biocelle
XC-B1150/100	BME Amino Acids 100X w_o L_Glutamine _ 100 ml	100 ml	77-Eur	Biosera
PEPT270	Regular Peptide of 41-50 amino acids>95%	5-9 mg	77-Eur	British Biocelle
PEPT201	Regular Peptide of 41-50 amino acids>85%	10-14 mg	77-Eur	British Biocelle
PEPT284	Regular Peptide of 5-30 amino acids>98%	15-19 mg	77-Eur	British Biocelle
PEPT124	Regular Peptide of 31-40 amino acids>75%	30-39 mg	76-Eur	British Biocelle
PEPT128	Regular Peptide of 31-40 amino acids>75%	80-100 mg	92-Eur	British Biocelle
PEPT263	Regular Peptide of 31-40 amino acids>95%	25-29 mg	88-Eur	British Biocelle
PEPT239	Regular Peptide of 41-50 amino acids>90%	25-29 mg	88-Eur	British Biocelle
PEPT205	Regular Peptide of 41-50 amino acids>85%	30-39 mg	88-Eur	British Biocelle
PEPT196	Regular Peptide of 31-40 amino acids>85%	50-59 mg	88-Eur	British Biocelle
PEPT288	Regular Peptide of 5-30 amino acids>98%	40-49 mg	88-Eur	British Biocelle
PEPT230	Regular Peptide of 31-40 amino acids>90%	40-49 mg	88-Eur	British Biocelle
PEPT204	Regular Peptide of 41-50 amino acids>85%	25-29 mg	86-Eur	British Biocelle
PEPT272	Regular Peptide of 41-50 amino acids>95%	15-19 mg	86-Eur	British Biocelle
PEPT162	Regular Peptide of 31-40 amino acids>80%	60-79 mg	89-Eur	British Biocelle
PEPT172	Regular Peptide of 41-50 amino acids>80%	50-59 mg	90-Eur	British Biocelle
PEPT289	Regular Peptide of 5-30 amino acids>98%	50-59 mg	90-Eur	British Biocelle
PEPT138	Regular Peptide of 41-50 amino acids>75%	60-79 mg	92-Eur	British Biocelle
PEPT295	Regular Peptide of 31-40 amino acids>98%	10-14 mg	92-Eur	British Biocelle
PEPT240	Regular Peptide of 41-50 amino acids>90%	30-39 mg	91-Eur	British Biocelle
PEPT273	Regular Peptide of 41-50 amino acids>95%	20-24 mg	91-Eur	British Biocelle
PEPT305	Regular Peptide of 41-50 amino acids>98%	5-9 mg	91-Eur	British Biocelle
PEPT264	Regular Peptide of 31-40 amino acids>95%	30-39 mg	91-Eur	British Biocelle
PEPT231	Regular Peptide of 31-40 amino acids>90%	50-59 mg	91-Eur	British Biocelle
PEPT206	Regular Peptide of 41-50 amino acids>85%	40-49 mg	90-Eur	British Biocelle
PEPT238	Regular Peptide of 41-50 amino acids>90%	20-24 mg	86-Eur	British Biocelle
PEPT127	Regular Peptide of 31-40 amino acids>75%	60-79 mg	86-Eur	British Biocelle
PEPT257	Regular Peptide of 5-30 amino acids>95%	100mg	86-Eur	British Biocelle
PEPT286	Regular Peptide of 5-30 amino acids>98%	25-29 mg	83-Eur	British Biocelle
PEPT237	Regular Peptide of 41-50 amino acids>90%	15-19 mg	83-Eur	British Biocelle
PEPT256	Regular Peptide of 5-30 amino acids>95%	80mg	83-Eur	British Biocelle
PEPT228	Regular Peptide of 31-40 amino acids>90%	25-29 mg	83-Eur	British Biocelle
PEPT194	Regular Peptide of 31-40 amino acids>85%	30-39 mg	83-Eur	British Biocelle
PEPT169	Regular Peptide of 41-50 amino acids>80%	25-29 mg	82-Eur	British Biocelle
PEPT222	Regular Peptide of 5-30 amino acids>90%	100mg	82-Eur	British Biocelle
PEPT271	Regular Peptide of 41-50 amino acids>95%	10-14 mg	82-Eur	British Biocelle
PEPT203	Regular Peptide of 41-50 amino acids>85%	20-24 mg	84-Eur	British Biocelle
PEPT161	Regular Peptide of 31-40 amino acids>80%	50-59 mg	84-Eur	British Biocelle
PEPT170	Regular Peptide of 41-50 amino acids>80%	30-39 mg	84-Eur	British Biocelle
PEPT171	Regular Peptide of 41-50 amino acids>80%	40-49 mg	86-Eur	British Biocelle
PEPT137	Regular Peptide of 41-50 amino acids>75%	50-59 mg	86-Eur	British Biocelle
PEPT229	Regular Peptide of 31-40 amino acids>90%	30-39 mg	86-Eur	British Biocelle
PEPT294	Regular Peptide of 31-40 amino acids>98%	5-9 mg	85-Eur	British Biocelle
PEPT287	Regular Peptide of 5-30 amino acids>98%	30-39 mg	85-Eur	British Biocelle
PEPT262	Regular Peptide of 31-40 amino acids>95%	20-24 mg	85-Eur	British Biocelle
PEPT104	Regular Peptide of 41-50 amino acids>70%	80-100 mg	85-Eur	British Biocelle
PEPT195	Regular Peptide of 31-40 amino acids>85%	40-49 mg	85-Eur	British Biocelle
PEPT136	Regular Peptide of 41-50 amino acids>75%	40-49 mg	81-Eur	British Biocelle
NU-1106L	Nucleic acids: 6-Thio-GTP, L pack	750Units	331-Eur	Jena Bio
NU-1190L	Nucleic acids: 4-O-i-butyl-UTP, L pack	100Units	316-Eur	Jena Bio
NU-901L	Nucleic acids: dUDP, L pack	750Units	331-Eur	Jena Bio
NU-1173S	Nucleic acids: 2-Hydroxy-ATP, S Pack (iso-GTP)	50Units	128-Eur	Jena Bio
NU-1173L	Nucleic acids: 2-Hydroxy-ATP, L pack (iso-GTP)	250Units	316-Eur	Jena Bio
NU-1609-655	Nucleic acids: EDA-ATPgammaS - ATTO-655	50	1714-Eur	Jena Bio
E02E0166	Rat Epoxyeicosatrienoic acids ELISA, EETs		689-Eur	Blue Gene Biotech	Elisa kits
E02U0003	Rat w-3 unsaturated fatty acids ELISA , w-3 UFA		689-Eur	Blue Gene Biotech	Elisa kits
NU-1609-656	Nucleic acids: EDA-ATPgammaS - OYSTER-656	50	1714-Eur	Jena Bio
NU-1609-660Q	Nucleic acids: EDA-ATPgammaS - DYQ-660	50	1714-Eur	Jena Bio
NU-1609-661Q	Nucleic acids: EDA-ATPgammaS - DYQ-661	50	1714-Eur	Jena Bio
NU-1609-665	Nucleic acids: EDA-ATPgammaS - ATTO-665	500	1714-Eur	Jena Bio
NU-1609-680	Nucleic acids: EDA-ATPgammaS - ATTO-680	50	1714-Eur	Jena Bio
C004-500GM	Peptone,Casamino Acids	500GM	117-Eur	Caisson Laboratory
NU-850-TXR	Nucleic acids: 5-Propargylamino-ddCTP - Texas Red	240	746-Eur	Jena Bio
NU-901S	Nucleic acids: dUDP, S pack	150Units	133-Eur	Jena Bio
NU-1609-633	Nucleic acids: EDA-ATPgammaS - ATTO-633	50	1714-Eur	Jena Bio
NU-1609-620	Nucleic acids: EDA-ATPgammaS - ATTO-620	50	1714-Eur	Jena Bio
201-12-1911	Human lipoteichoic acids,LTA ELISA Kit	96T	476-Eur	SunBT	Elisa kits
NU-908S	Nucleic acids: 9-Deaza-GMP, S pack	100Units	128-Eur	Jena Bio
NU-908L	Nucleic acids: 9-Deaza-GMP, L pack	500Units	316-Eur	Jena Bio
NU-907-1	Nucleic acids: dTpNHpp, 1 mg pack (dTMPNPP)	1mg	300-Eur	Jena Bio
NU-906S	Nucleic acids: 8-Morpholinyl-GTP, S pack	50Units	128-Eur	Jena Bio
NU-906L	Nucleic acids: 8-Morpholinyl-GTP, L pack	250Units	316-Eur	Jena Bio
NU-1183S	Nucleic acids: N3-Phenacyl-UDP, S pack	50Units	128-Eur	Jena Bio
NU-1183L	Nucleic acids: N3-Phenacyl-UDP, L pack	250Units	316-Eur	Jena Bio
NU-904S	Nucleic acids: 8-Trifluoromethyl-ADP, S pack	50Units	128-Eur	Jena Bio
NU-904L	Nucleic acids: 8-Trifluoromethyl-ADP, L pack	250Units	316-Eur	Jena Bio
NU-117S	Nucleic acids: 8Br-dATP, S pack	50Units	128-Eur	Jena Bio
NU-117L	Nucleic acids: 8Br-dATP, L pack	250Units	316-Eur	Jena Bio
NU-1609-594	Nucleic acids: EDA-ATPgammaS - ATTO-594	50	1714-Eur	Jena Bio
NU-850-TAM	Nucleic acids: 5-Propargylamino-ddCTP - 5_6-TAMRA	60	209-Eur	Jena Bio
NU-850-MNT	Nucleic acids: 5-Propargylamino-ddCTP - MANT	200	746-Eur	Jena Bio
NU-850-655	Nucleic acids: 5-Propargylamino-ddCTP - ATTO-655	80	746-Eur	Jena Bio
NU-1169S	Nucleic acids: ddUMP, S pack	50Units	128-Eur	Jena Bio
NU-1169L	Nucleic acids: ddUMP, L pack	250Units	316-Eur	Jena Bio
NU-1168S	Nucleic acids: S-Ethyl-CoA, S pack	20Units	128-Eur	Jena Bio
NU-1168L	Nucleic acids: S-Ethyl-CoA, L pack	100Units	316-Eur	Jena Bio
NU-850-633	Nucleic acids: 5-Propargylamino-ddCTP - ATTO-633	80	746-Eur	Jena Bio
NU-850-620	Nucleic acids: 5-Propargylamino-ddCTP - ATTO-620	80	746-Eur	Jena Bio
NU-1165S	Nucleic acids: dADPalphaS, S pack	20Units	128-Eur	Jena Bio
NU-1165L	Nucleic acids: dADPalphaS, L pack	100Units	316-Eur	Jena Bio
NU-1164S	Nucleic acids: dGDPalphaS, S pack	20Units	128-Eur	Jena Bio
NU-1164L	Nucleic acids: dGDPalphaS, L pack	100Units	316-Eur	Jena Bio
NU-1162S	Nucleic acids: Desulpho-CoA, S pack	20Units	128-Eur	Jena Bio
NU-1162L	Nucleic acids: Desulpho-CoA, L pack	100Units	316-Eur	Jena Bio
NU-850-656	Nucleic acids: 5-Propargylamino-ddCTP - OYSTER-656	80	746-Eur	Jena Bio
NU-850-660Q	Nucleic acids: 5-Propargylamino-ddCTP - DYQ-660	80	746-Eur	Jena Bio
NU-850-661Q	Nucleic acids: 5-Propargylamino-ddCTP - DYQ-661	80	746-Eur	Jena Bio
NU-850-MB2	Nucleic acids: 5-Propargylamino-ddCTP - ATTO-MB2	80	746-Eur	Jena Bio
NU-850-751	Nucleic acids: 5-Propargylamino-ddCTP - DY751	80	746-Eur	Jena Bio
NU-1503L	Nucleic acids: cAMP, L pack	2500mg	174-Eur	Jena Bio
E1910Hu	Human lipoteichoic acids,LTA ELISA Kit	96T	533-Eur	Eastbio	Elisa kits
NU-850-740	Nucleic acids: 5-Propargylamino-ddCTP - ATTO-740	80	746-Eur	Jena Bio
E0738Ra	Rat free fatty acids,FFA ELISA Kit	96T	595-Eur	Eastbio	Elisa kits
E0796Ra	Rat free KXtty acids,FKX ELISA KIT	96T	595-Eur	Eastbio	Elisa kits
NU-850-725	Nucleic acids: 5-Propargylamino-ddCTP - ATTO-725	80	746-Eur	Jena Bio
E1910Hu	Human lipoteichoic acids,LTA ELISA Kit	48T	356-Eur	Eastbio	Elisa kits
NU-850-700	Nucleic acids: 5-Propargylamino-ddCTP - ATTO-700	80	746-Eur	Jena Bio
E0796Ra	Rat free KXtty acids,FKX ELISA KIT	48T	379-Eur	Eastbio	Elisa kits
NU-850-680	Nucleic acids: 5-Propargylamino-ddCTP - ATTO-680	80	746-Eur	Jena Bio
NU-850-665	Nucleic acids: 5-Propargylamino-ddCTP - ATTO-665	400	746-Eur	Jena Bio
NU-1161S	Nucleic acids: AMPalphaS, S pack	100Units	128-Eur	Jena Bio
NU-1609-465	Nucleic acids: EDA-ATPgammaS - ATTO-465	50	1714-Eur	Jena Bio
25-536	Non-Essential Amino Acids 100 X Solution, Sterile	6 x 100ml/Unit	103-Eur	Genesee
NU-1502S	Nucleic acids: 8Br-cAMP, S pack	10mg	128-Eur	Jena Bio
NU-1502L	Nucleic acids: 8Br-cAMP, L pack	50mg	316-Eur	Jena Bio
NU-1501-50	Nucleic acids: cGMP, 50 mg pack	50mg	128-Eur	Jena Bio
NU-1501-250	Nucleic acids: cGMP, 250 mg pack	250mg	316-Eur	Jena Bio
NU-134S	Nucleic acids: 5Br-dCMP, S pack	100Units	128-Eur	Jena Bio
NU-134L	Nucleic acids: 5Br-dCMP, L pack	500Units	316-Eur	Jena Bio
NU-133S	Nucleic acids: 5Br-dCDP, S pack	50Units	128-Eur	Jena Bio
NU-133L	Nucleic acids: 5Br-dCDP, L pack	250Units	316-Eur	Jena Bio
NU-132S	Nucleic acids: 5Br-dCTP, S pack	50Units	128-Eur	Jena Bio
NU-132L	Nucleic acids: 5Br-dCTP, L pack	250Units	316-Eur	Jena Bio
NU-130S	Nucleic acids: 5I-dUMP, S pack	100Units	128-Eur	Jena Bio
NU-130L	Nucleic acids: 5I-dUMP, L pack	500Units	316-Eur	Jena Bio
NU-1503S	Nucleic acids: cAMP, S pack	500mg	69-Eur	Jena Bio
NU-1609-550	Nucleic acids: EDA-ATPgammaS - ATTO-550	50	1714-Eur	Jena Bio
NU-1609-532	Nucleic acids: EDA-ATPgammaS - ATTO-532	50	1714-Eur	Jena Bio
NU-1609-425	Nucleic acids: EDA-ATPgammaS - ATTO-425	50	1714-Eur	Jena Bio
NU-1609-390	Nucleic acids: EDA-ATPgammaS - ATTO-390	50	1714-Eur	Jena Bio
NU-1609-488	Nucleic acids: EDA-ATPgammaS - ATTO-488	50	1714-Eur	Jena Bio
NU-1609-495	Nucleic acids: EDA-ATPgammaS - ATTO-495	50	1714-Eur	Jena Bio
NU-155S	Nucleic acids: 8-Azido-ATP, S pack	100Units	128-Eur	Jena Bio
NU-155L	Nucleic acids: 8-Azido-ATP, L pack	500Units	316-Eur	Jena Bio
NU-154S	Nucleic acids: 5F-dUTP, S pack	50Units	128-Eur	Jena Bio
NU-154L	Nucleic acids: 5F-dUTP, L pack	250Units	316-Eur	Jena Bio
NU-153S	Nucleic acids: 5F-dUMP, S pack	50Units	128-Eur	Jena Bio
NU-153L	Nucleic acids: 5F-dUMP, L pack	250Units	316-Eur	Jena Bio
NU-152S	Nucleic acids: 2'F-dAMP, S pack	50Units	128-Eur	Jena Bio
NU-151S	Nucleic acids: 2'F-dATP, S pack	50Units	128-Eur	Jena Bio
NU-151L	Nucleic acids: 2'F-dATP, L pack	250Units	316-Eur	Jena Bio
NU-129S	Nucleic acids: 5Br-dUDP, S pack	30Units	128-Eur	Jena Bio
NU-129L	Nucleic acids: 5Br-dUDP, L pack	150Units	316-Eur	Jena Bio
201-11-0739	Rat free fatty acids,FFA ELISA Kit	96T	490-Eur	SunBT	Elisa kits
201-12-1911	Human lipoteichoic acids,LTA ELISA Kit	48T	295-Eur	SunBT	Elisa kits
NU-1196S	Nucleic acids: N6-Benzyl-ATP, S pack	300Units	128-Eur	Jena Bio
NU-1196L	Nucleic acids: N6-Benzyl-ATP, L pack	1500Units	316-Eur	Jena Bio
NU-1195S	Nucleic acids: N6-Benzyl-AMP, S pack	300Units	128-Eur	Jena Bio
NU-1195L	Nucleic acids: N6-Benzyl-AMP, L pack	1500Units	316-Eur	Jena Bio
NU-1194S	Nucleic acids: N6-Benzyl-ADP, S pack	300Units	128-Eur	Jena Bio
NU-1194L	Nucleic acids: N6-Benzyl-ADP, L pack	1500Units	316-Eur	Jena Bio
NU-916-CY3	Nucleic acids: gamma-[6-Aminohexyl]-dGTP - Cy3	30	209-Eur	Jena Bio
NU-1192S	Nucleic acids: 4-N-Methyl-CTP, S pack	20Units	128-Eur	Jena Bio
NU-1192L	Nucleic acids: 4-N-Methyl-CTP, L pack	100Units	316-Eur	Jena Bio
NU-1191S	Nucleic acids: 4-N-Ethyl-CTP, S pack	20Units	128-Eur	Jena Bio
NU-1191L	Nucleic acids: 4-N-Ethyl-CTP, L pack	100Units	316-Eur	Jena Bio
NU-1205L	Nucleic acids: cIMP, L pack	250Units	316-Eur	Jena Bio
NU-1205S	Nucleic acids: cIMP, S pack	50Units	128-Eur	Jena Bio
NU-1207-10	Nucleic acids: dTDP, lyophilized - 10 mg	10mg	80-Eur	Jena Bio
NU-128S	Nucleic acids: 5I-dCTP, S pack	50Units	128-Eur	Jena Bio
NU-128L	Nucleic acids: 5I-dCTP, L pack	250Units	316-Eur	Jena Bio
NU-1609-565	Nucleic acids: EDA-ATPgammaS - ATTO-565	50	1714-Eur	Jena Bio
NU-1609-590	Nucleic acids: EDA-ATPgammaS - ATTO-590	50	1714-Eur	Jena Bio
E01U0003	Human w-3 unsaturated fatty acids	96 Tests/kit	761-Eur	Other suppliers
NU-925-BIO-S	Nucleic acids: Biotin-dC-puromycin, S pack	100	128-Eur	Jena Bio
NU-925-BIO-L	Nucleic acids: Biotin-dC-puromycin, L pack	500	316-Eur	Jena Bio
201-11-0797	Rat free KXtty acids,FKX ELISA KIT	96T	490-Eur	SunBT	Elisa kits
NU-121S	Nucleic acids: 5Br-UTP (5-BrUTP), S pack	50Units	128-Eur	Jena Bio
NU-121L	Nucleic acids: 5Br-UTP (5-BrUTP), L pack	250Units	316-Eur	Jena Bio
NU-120S	Nucleic acids: 5I-dUTP, S pack	50Units	133-Eur	Jena Bio
NU-120L	Nucleic acids: 5I-dUTP, L pack	250Units	331-Eur	Jena Bio
NU-1207-100	Nucleic acids: dTDP, lyophilized - 100 mg	100mg	347-Eur	Jena Bio
NU-1190S	Nucleic acids: 4-O-i-butyl-UTP, S pack	20Units	128-Eur	Jena Bio
NU-850-565	Nucleic acids: 5-Propargylamino-ddCTP - ATTO-565	160	746-Eur	Jena Bio
NU-850-488	Nucleic acids: 5-Propargylamino-ddCTP - ATTO-488	80	746-Eur	Jena Bio
NU-1135S	Nucleic acids: m7GMP, S pack	100Units	133-Eur	Jena Bio
NU-850-465	Nucleic acids: 5-Propargylamino-ddCTP - ATTO-465	160	746-Eur	Jena Bio
N-1048	Nucleic acids: 3'-Deoxyguanosine, 25 mg pack	25mg	342-Eur	Jena Bio
N-1050	Nucleic acids: Xanthosine, 1 g pack	1g	51-Eur	Jena Bio
NU-1135L	Nucleic acids: m7GMP, L pack	500Units	331-Eur	Jena Bio
NU-1134S	Nucleic acids: m7GDP, S pack	50Units	128-Eur	Jena Bio
NU-1134L	Nucleic acids: m7GDP, L pack	250Units	316-Eur	Jena Bio
NU-1133L	Nucleic acids: 6-Methylthio-ITP, L pack	750Units	316-Eur	Jena Bio
NU-1132S	Nucleic acids: 6-Methylthio-IDP, S pack	100Units	128-Eur	Jena Bio
NU-1132L	Nucleic acids: 6-Methylthio-IDP, L pack	500Units	316-Eur	Jena Bio
NU-1131S	Nucleic acids: 6-Methylthio-IMP, S pack	150Units	128-Eur	Jena Bio
PEPT149	Regular Peptide of 5-30 amino acids>80%	50-59 mg	68-Eur	British Biocelle
LIB-102	Nucleic acids: Guanosine Nucleotide Library	80nucleotides	3215-Eur	Jena Bio
NU-850-550	Nucleic acids: 5-Propargylamino-ddCTP - ATTO-550	80	746-Eur	Jena Bio
NU-1133S	Nucleic acids: 6-Methylthio-ITP, S pack	150Units	128-Eur	Jena Bio
FP-21031	Nucleic acids: pGLOW-FBs1	1Plasmid	556-Eur	Jena Bio
FP-21032	Nucleic acids: pGLOW-FBs2	1Plasmid	556-Eur	Jena Bio
FP-21033	Nucleic acids: pGLOW-FPp1	1Plasmid	556-Eur	Jena Bio
FP-21043	Nucleic acids: pGLOW-ActXN-YT	1Plasmid	556-Eur	Jena Bio
NU-850-532	Nucleic acids: 5-Propargylamino-ddCTP - ATTO-532	160	746-Eur	Jena Bio
FP-21045	Nucleic acids: pGLOW-GalXN-YT	1Plasmid	556-Eur	Jena Bio
FP-21065	Nucleic acids: pGlow-CKXN-Bs2	1Plasmid	556-Eur	Jena Bio
NU-1153S	Nucleic acids: 8-Oxo-dGMP, S pack	50Units	128-Eur	Jena Bio
FP-21066	Nucleic acids: pGlow-CKXN-Pp1	1Plasmid	556-Eur	Jena Bio
LIB-101	Nucleic acids: Adenosine Nucleotide Library	80nucleotides	3215-Eur	Jena Bio
NU-1131L	Nucleic acids: 6-Methylthio-IMP, L pack	750Units	316-Eur	Jena Bio
NU-1130S	Nucleic acids: 6-Methylthio-GTP, S pack	100Units	128-Eur	Jena Bio
NU-1130L	Nucleic acids: 6-Methylthio-GTP, L pack	500Units	316-Eur	Jena Bio
NU-1122S	Nucleic acids: m7GTP, S pack	100Units	133-Eur	Jena Bio
NU-1122L	Nucleic acids: m7GTP, L pack	500Units	331-Eur	Jena Bio
T002-500GM	Amino Acids,L-Threonine	500G	183-Eur	Caisson Laboratory
NU-1121S	Nucleic acids: 6-Thio-GMP, S pack	150Units	133-Eur	Jena Bio
NU-1121L	Nucleic acids: 6-Thio-GMP, L pack	750Units	331-Eur	Jena Bio
NU-1120S	Nucleic acids: 6-Thio-GDP, S pack	50Units	128-Eur	Jena Bio
NU-1120L	Nucleic acids: 6-Thio-GDP, L pack	250Units	316-Eur	Jena Bio
NU-1119S	Nucleic acids: dPTP, S pack	30Units	133-Eur	Jena Bio
NU-1119L	Nucleic acids: dPTP, L pack	150Units	331-Eur	Jena Bio
NU-1117S	Nucleic acids: 8-Oxo-dGTP, S pack	30Units	133-Eur	Jena Bio
NU-1117L	Nucleic acids: 8-Oxo-dGTP, L pack	150Units	331-Eur	Jena Bio
T002-100GM	Amino Acids,L-Threonine	100G	79-Eur	Caisson Laboratory
T008-100GM	Amino Acids,L-Tryptophan	100G	109-Eur	Caisson Laboratory
T008-500GM	Amino Acids,L-Tryptophan	500G	271-Eur	Caisson Laboratory
NU-1129S	Nucleic acids: 6-Methylthio-GDP, S pack	50Units	128-Eur	Jena Bio
NU-1129L	Nucleic acids: 6-Methylthio-GDP, L pack	250Units	316-Eur	Jena Bio
NU-1128S	Nucleic acids: 6-Methylthio-GMP, S pack	100Units	128-Eur	Jena Bio
NU-1128L	Nucleic acids: 6-Methylthio-GMP, L pack	500Units	316-Eur	Jena Bio
NU-850-425	Nucleic acids: 5-Propargylamino-ddCTP - ATTO-425	160	746-Eur	Jena Bio
NU-850-390	Nucleic acids: 5-Propargylamino-ddCTP - ATTO-390	160	746-Eur	Jena Bio
NU-850-1	Nucleic acids: 5-Propargylamino-ddCTP, 1 mg pack	1mg	574-Eur	Jena Bio
C004-100GM	Peptone,Casamino Acids	100GM	69-Eur	Caisson Laboratory
N-1056	Nucleic acids: Pseudouridine, 100 mg pack	100mg	342-Eur	Jena Bio
NU-850-495	Nucleic acids: 5-Propargylamino-ddCTP - ATTO-495	160	746-Eur	Jena Bio
V001-500GM	Amino Acids,L-Valine	100GM	108-Eur	Caisson Laboratory
V001-100GM	Amino Acids,L-Valine	100GM	72-Eur	Caisson Laboratory
NU-1106S	Nucleic acids: 6-Thio-GTP, S pack	150Units	133-Eur	Jena Bio
NU-1138L	Nucleic acids: 5-Methyl-CTP, L pack	500	316-Eur	Jena Bio
NU-1155S	Nucleic acids: 4-Thio-UDP, S pack	20Units	128-Eur	Jena Bio
CLK-NU-003-5	Nucleic acids: N6-(6-Azido)hexyl-ATP, L pack	5mg	389-Eur	Jena Bio
NU-1159L	Nucleic acids: dPDP, L pack	100Units	316-Eur	Jena Bio
CSS-162	Organic acids or its substitutes: Citric Acid pH 3.1, 1 M	100ml	66-Eur	Jena Bio
CSS-197	Organic acids or its substitutes: L-Malic Acid pH 7.0, 1 M	100ml	66-Eur	Jena Bio
NU-1159S	Nucleic acids: dPDP, S pack	20Units	128-Eur	Jena Bio
CSS-307	Organic acids or its substitutes: Succinic Acid, 0.5 M	100ml	51-Eur	Jena Bio
NU-1157L	Nucleic acids: 8-Oxo-dGP4, L pack	100Units	316-Eur	Jena Bio
CSS-342	Organic acids or its substitutes: Citric Acid pH 4.2, 1 M	100ml	66-Eur	Jena Bio
CSS-343	Organic acids or its substitutes: Citric Acid pH 5.0, 1 M	100ml	66-Eur	Jena Bio
NU-1160L	Nucleic acids: GMPalphaS, L pack	500Units	316-Eur	Jena Bio
NU-1158S	Nucleic acids: 8-Oxo-dGDP, S pack	20Units	128-Eur	Jena Bio
CLK-NU-003-1	Nucleic acids: N6-(6-Azido)hexyl-ATP, S pack	1mg	120-Eur	Jena Bio
NU-1156S	Nucleic acids: 4-Thio-UTP, S pack	100Units	133-Eur	Jena Bio
NU-1157S	Nucleic acids: 8-Oxo-dGP4, S pack	20Units	128-Eur	Jena Bio
NU-1155L	Nucleic acids: 4-Thio-UDP, L pack	100Units	316-Eur	Jena Bio
NU-1154S	Nucleic acids: 4-Thio-UMP, S pack	50Units	128-Eur	Jena Bio
NU-1154L	Nucleic acids: 4-Thio-UMP, L pack	250Units	316-Eur	Jena Bio
NU-1153L	Nucleic acids: 8-Oxo-dGMP, L pack	250Units	316-Eur	Jena Bio
NU-1151	Nucleic acids: 2-Thio-UTP, 1 mg pack	1mg	209-Eur	Jena Bio
NU-1158L	Nucleic acids: 8-Oxo-dGDP, L pack	100Units	316-Eur	Jena Bio
NU-850-594	Nucleic acids: 5-Propargylamino-ddCTP - ATTO-594	80	746-Eur	Jena Bio
NU-850-590	Nucleic acids: 5-Propargylamino-ddCTP - ATTO-590	160	746-Eur	Jena Bio
NU-1145S	Nucleic acids: 3'-dGTP, S pack	50Units	133-Eur	Jena Bio
NU-1145L	Nucleic acids: 3'-dGTP, L pack	250Units	331-Eur	Jena Bio
NU-1143S	Nucleic acids: 3'-dGMP, S pack	50Units	128-Eur	Jena Bio
NU-1161L	Nucleic acids: AMPalphaS, L pack	500Units	316-Eur	Jena Bio
NU-1143L	Nucleic acids: 3'-dGMP, L pack	250Units	316-Eur	Jena Bio
NU-1144L	Nucleic acids: 3'-dGDP, L pack	100Units	316-Eur	Jena Bio
NU-1156L	Nucleic acids: 4-Thio-UTP, L pack	500Units	331-Eur	Jena Bio
NU-1138S	Nucleic acids: 5-Methyl-CTP, S pack	100	128-Eur	Jena Bio
NU-1144S	Nucleic acids: 3'-dGDP, S pack	20Units	128-Eur	Jena Bio
NU-1160S	Nucleic acids: GMPalphaS, S pack	100Units	128-Eur	Jena Bio
NU-1619-425	Nucleic acids: 5-Propargylamino-ddUTP - ATTO-425	160	746-Eur	Jena Bio
NU-1619-465	Nucleic acids: 5-Propargylamino-ddUTP - ATTO-465	160	746-Eur	Jena Bio
NU-1008	Nucleic acids: dUTP - solution, pack 100 mM	1ml	96-Eur	Jena Bio
NU-1619-594	Nucleic acids: 5-Propargylamino-ddUTP - ATTO-594	80	746-Eur	Jena Bio
NU-1615-776	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - DY-776	40	1095-Eur	Jena Bio
NU-1619-488	Nucleic acids: 5-Propargylamino-ddUTP - ATTO-488	160	746-Eur	Jena Bio
NU-1615-751	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - DY-751	40	1095-Eur	Jena Bio
NU-1619-390	Nucleic acids: 5-Propargylamino-ddUTP - ATTO-390	160	746-Eur	Jena Bio
NU-1619-590	Nucleic acids: 5-Propargylamino-ddUTP - ATTO-590	160	746-Eur	Jena Bio
NU-1619-620	Nucleic acids: 5-Propargylamino-ddUTP - ATTO-620	80	746-Eur	Jena Bio
NU-1619-633	Nucleic acids: 5-Propargylamino-ddUTP - ATTO-633	80	746-Eur	Jena Bio
NU-1001-10	Nucleic acids: dATP - lyophilized, 10 mg pack	10mg	53-Eur	Jena Bio
NU-1611-776	Nucleic acids: 7-Propargylamino-7-deaza-dATP - DY-776	40	746-Eur	Jena Bio
NU-1619-565	Nucleic acids: 5-Propargylamino-ddUTP - ATTO-565	160	746-Eur	Jena Bio
NU-1004-10	Nucleic acids: dTTP - lyophilized, 10 mg pack	10mg	53-Eur	Jena Bio
NU-1612-5FM	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - 5-FAM	240	746-Eur	Jena Bio
NU-1615-JOE	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - 6-JOE	120	1095-Eur	Jena Bio
NU-1615-CY5	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - Cy5	300	1095-Eur	Jena Bio
NU-1003	Nucleic acids: dGTP - solution, pack 100 mM	1ml	82-Eur	Jena Bio
NU-1611-751	Nucleic acids: 7-Propargylamino-7-deaza-dATP - DY-751	40	746-Eur	Jena Bio
L006-100GM	Amino Acids,L-Lysine, Hydrochloride	100G	64-Eur	Caisson Laboratory
NU-1003-10	Nucleic acids: dGTP - lyophilized, 10 mg pack	10mg	53-Eur	Jena Bio
NU-1611-CY3	Nucleic acids: 7-Propargylamino-7-deaza-dATP - Cy3	30	209-Eur	Jena Bio
NU-1611-CY5	Nucleic acids: 7-Propargylamino-7-deaza-dATP - Cy5	60	209-Eur	Jena Bio
NU-1611-6FM	Nucleic acids: 7-Propargylamino-7-deaza-dATP - 6-FAM	120	746-Eur	Jena Bio
NU-1615-ROX	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - 6-ROX	120	1095-Eur	Jena Bio
NU-1004	Nucleic acids: dTTP - solution, pack 100 mM	1ml	82-Eur	Jena Bio
NU-1619-495	Nucleic acids: 5-Propargylamino-ddUTP - ATTO-495	80	746-Eur	Jena Bio
NU-1615-CY3	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - Cy3	120	1095-Eur	Jena Bio
NU-1619-532	Nucleic acids: 5-Propargylamino-ddUTP - ATTO-532	80	746-Eur	Jena Bio
NU-1619-550	Nucleic acids: 5-Propargylamino-ddUTP - ATTO-550	40	746-Eur	Jena Bio
NU-1619-1	Nucleic acids: 5-Propargylamino-ddUTP, 1 mg pack	1mg	574-Eur	Jena Bio
A013-500GM	Amino Acids,L-Aspartic Acid	500G	91-Eur	Caisson Laboratory
NU-1612-JOE	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - 6-JOE	120	746-Eur	Jena Bio
NU-1612-ROX	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - 6-ROX	240	746-Eur	Jena Bio
NU-1618-6FM	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - 6-FAM	240	1175-Eur	Jena Bio
C010-1KG	Amino Acids,L-Cysteine, Hydrochloride, Monohydrate	1KG	294-Eur	Caisson Laboratory
N-RP-1034-25	Nucleic acids: N3-methyl-uridine, 25 mg pack	25mg	112-Eur	Jena Bio
NU-1618-ROX	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - 6-ROX	480	1175-Eur	Jena Bio
N-RP-1034-100	Nucleic acids: N3-methyl-uridine, 100 mg pack	100mg	257-Eur	Jena Bio
NU-1612-6FM	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - 6-FAM	240	746-Eur	Jena Bio
N-RP-1187-100G	Nucleic acids: Inosine, 100 g pack	100g	141-Eur	Jena Bio
A031-25GM	Amino Acids,L-Asparagine, Anhydrous	25G	63-Eur	Caisson Laboratory
NU-1618-5FM	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - 5-FAM	240	1175-Eur	Jena Bio
NU-1612-CY3	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - Cy3	120	746-Eur	Jena Bio
NU-1612-CY5	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - Cy5	120	746-Eur	Jena Bio
N-RP-2304-250	Nucleic acids: 4-Thio-uridine, 250 mg pack	250mg	307-Eur	Jena Bio
A031-100GM	Amino Acids,L-Asparagine, Anhydrous	100G	79-Eur	Caisson Laboratory
N-RP-2304-100	Nucleic acids: 4-Thio-uridine, 100 mg pack	100mg	169-Eur	Jena Bio
NU-1612-776	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - DY-776	80	746-Eur	Jena Bio
NU-1612-751	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - DY-751	80	746-Eur	Jena Bio
NU-1617S	Nucleic acids: UTP-gamma-AmNS, S pack	150	128-Eur	Jena Bio
NU-1010-100G	Nucleic acids: ATP - lyophilized, 100 g pack	100g	374-Eur	Jena Bio
NU-1611-ROX	Nucleic acids: 7-Propargylamino-7-deaza-dATP - 6-ROX	120	746-Eur	Jena Bio
NU-1616L	Nucleic acids: ATP-gamma-AmNS, L pack	750	316-Eur	Jena Bio
NU-1002	Nucleic acids: dCTP - solution, pack 100 mM	1ml	82-Eur	Jena Bio
NU-1615-5FM	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - 5-FAM	120	1095-Eur	Jena Bio
NU-1615-6FM	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - 6-FAM	120	1095-Eur	Jena Bio
NU-1002-10	Nucleic acids: dCTP - lyophilized, 10 mg pack	10mg	53-Eur	Jena Bio
L006-500GM	Amino Acids,L-Lysine, Hydrochloride	500G	80-Eur	Caisson Laboratory
NU-1618-CY3	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - Cy3	120	1175-Eur	Jena Bio
NU-1618-CY5	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - Cy5	240	1175-Eur	Jena Bio
NU-1616S	Nucleic acids: ATP-gamma-AmNS, S pack	150	128-Eur	Jena Bio
A013-100GM	Amino Acids,L-Aspartic Acid	100G	73-Eur	Caisson Laboratory
NU-1611-JOE	Nucleic acids: 7-Propargylamino-7-deaza-dATP - 6-JOE	120	746-Eur	Jena Bio
NU-1618-751	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - DY-751	80	1175-Eur	Jena Bio
NU-1618-776	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - DY-776	80	1175-Eur	Jena Bio
201-12-2014	Human free fatty acids,FFA ELISA Kit	96T	476-Eur	SunBT	Elisa kits
GLL01-100ML	Amino Acids,L-Glutamine Solution	100ml	56-Eur	Caisson Laboratory
NU-1001	Nucleic acids: dATP - solution, pack 100 mM	1ml	82-Eur	Jena Bio
NU-1617L	Nucleic acids: UTP-gamma-AmNS, L pack	750	316-Eur	Jena Bio
201-12-2014	Human free fatty acids,FFA ELISA Kit	48T	295-Eur	SunBT	Elisa kits
NU-1618-JOE	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - 6-JOE	240	1175-Eur	Jena Bio
E0621Mo	Mouse free fatty acids,FFA ELISA Kit	96T	595-Eur	Eastbio	Elisa kits
NU-115S	Nucleic acids: 8I-AppNHp, S pack (8I-AMPPNP)	20Units	128-Eur	Jena Bio
NU-115L	Nucleic acids: 8I-AppNHp, L pack (8I-AMPPNP)	100Units	316-Eur	Jena Bio
NU-1102S	Nucleic acids: AP4 , S pack (Adenosine-5'-tetraphosphate)	100Units	128-Eur	Jena Bio
CLK-N004-1	Nucleic acids: N6-Propargyl-Adenosine, S pack	1mg	92-Eur	Jena Bio
CLK-N004-5	Nucleic acids: N6-Propargyl-Adenosine, L pack	5mg	279-Eur	Jena Bio
CLK-NU-002-1	Nucleic acids: N6-(6-Azido)hexyl-dATP, S pack	1mg	120-Eur	Jena Bio
CLK-NU-002-5	Nucleic acids: N6-(6-Azido)hexyl-dATP, L pack	5mg	389-Eur	Jena Bio
NU-1149S	Nucleic acids: 5-AcOHg-dCTP, S pack	100Units	128-Eur	Jena Bio
NU-1149L	Nucleic acids: 5-AcOHg-dCTP, L pack	500Units	316-Eur	Jena Bio
NU-1137S	Nucleic acids: 5-Methyl-dCMP, S pack	100Units	128-Eur	Jena Bio
NU-1137L	Nucleic acids: 5-Methyl-dCMP, L pack	500Units	316-Eur	Jena Bio
NU-1136S	Nucleic acids: GppNH2, S pack (GMPPN)	150Units	128-Eur	Jena Bio
NU-1012-100G	Nucleic acids: GTP - lyophilized, 100 g pack	100g	2514-Eur	Jena Bio
FP-21044	Nucleic acids: pGLOW-ActXN-YT-double	1Plasmid	556-Eur	Jena Bio
FP-21046	Nucleic acids: pGLOW-GalXN-YT-double	1Plasmid	556-Eur	Jena Bio
NU-1163L	Nucleic acids: 5-Methyl-dCDP, L pack	250Units	316-Eur	Jena Bio
NU-1163S	Nucleic acids: 5-Methyl-dCDP, S pack	50Units	128-Eur	Jena Bio
NU-1166L	Nucleic acids: ZTP, L pack (AICAR triphosphate)	250Units	316-Eur	Jena Bio
E2013Hu	Human free fatty acids,FFA ELISA Kit	48T	356-Eur	Eastbio	Elisa kits
30626020-1	Yeast Nitrogen Base, w_o Amino Acids	100 g	82-Eur	Bioworld Consulting
30626020-2	Yeast Nitrogen Base, w_o Amino Acids	250 g	169-Eur	Bioworld Consulting
30626020-3	Yeast Nitrogen Base, w_o Amino Acids	500 g	258-Eur	Bioworld Consulting
30626020-4	Yeast Nitrogen Base, w_o Amino Acids	1 kg	404-Eur	Bioworld Consulting
30626021-1	Yeast Nitrogen Base, w_o Amino Acids & A	250 g	169-Eur	Bioworld Consulting
30626021-2	Yeast Nitrogen Base, w_o Amino Acids & A	500 g	258-Eur	Bioworld Consulting
06344-14	MEM Non‐Essential Amino Acids Solution(100x) CAS:	20ML	111-Eur	Nacala
06344-56	MEM Non‐Essential Amino Acids Solution(100x) CAS:	100ML	120-Eur	Nacala
NU-116S	Nucleic acids: 8Br-AppNHp, S pack (8Br-AMPPNP)	20Units	128-Eur	Jena Bio
NU-116L	Nucleic acids: 8Br-AppNHp, L pack (8Br-AMPPNP)	100Units	316-Eur	Jena Bio
NU-1136L	Nucleic acids: GppNH2, L pack (GMPPN)	750Units	316-Eur	Jena Bio
NU-1167S	Nucleic acids: ZDP, S pack (AICAR diphosphate)	20Units	128-Eur	Jena Bio
NU-1167L	Nucleic acids: ZDP, L pack (AICAR diphosphate)	100Units	316-Eur	Jena Bio
NU-1166S	Nucleic acids: ZTP, S pack (AICAR triphosphate)	50Units	128-Eur	Jena Bio
NU-1013-100G	Nucleic acids: UTP - lyophilized, 100 g pack	100g	2514-Eur	Jena Bio
N-1009	Nucleic acids: 3'-Amino-2'_3'-dideoxyinosine, 1 g pack	1g	238-Eur	Jena Bio
N-20337-10G	Nucleic acids: Arabinofuranosyl-isoguanine, 10 g pack	10g	8559-Eur	Jena Bio
NU-1114S	Nucleic acids: 2'OMe-Adenosine-3'_5'-bisphosphate, S pack (2'OMe-pAp)	100Units	128-Eur	Jena Bio
NU-1114L	Nucleic acids: 2'OMe-Adenosine-3'_5'-bisphosphate, L pack (2'OMe-pAp)	500Units	316-Eur	Jena Bio
NU-1113S	Nucleic acids: Adenosine-2'_5'-bisphosphate, S pack	100Units	128-Eur	Jena Bio
NU-103L	Nucleic acids: 2'I-AppNHp, L pack (2'I-AMPPNP)	100Units	316-Eur	Jena Bio
NU-103S	Nucleic acids: 2'I-AppNHp, S pack (2'I-AMPPNP)	20Units	128-Eur	Jena Bio
NU-1113L	Nucleic acids: Adenosine-2'_5'-bisphosphate, L pack	500Units	316-Eur	Jena Bio
NU-104L	Nucleic acids: 2'Br-AppNHp, L pack (2'Br-AMPPNP)	100Units	316-Eur	Jena Bio
NU-104S	Nucleic acids: 2'Br-AppNHp, S pack (2'Br-AMPPNP)	20Units	128-Eur	Jena Bio
NU-1112S	Nucleic acids: Adenosine-3'_5'-bisphosphate, S pack (pAp)	100Units	128-Eur	Jena Bio
NU-1112L	Nucleic acids: Adenosine-3'_5'-bisphosphate, L pack (pAp)	500Units	316-Eur	Jena Bio
NU-10703-10	Nucleic acids: 2-Fluoro-ara-adenosine-5'-triphosphate, 10	10	362-Eur	Jena Bio
NU-1108S	Nucleic acids: Guanosine-2'_5'-bisphosphate, S pack	100Units	128-Eur	Jena Bio
NU-1107S	Nucleic acids: Guanosine-3'_5'-bisphosphate, S pack (pGp)	100Units	128-Eur	Jena Bio
NU-1107L	Nucleic acids: Guanosine-3'_5'-bisphosphate, L pack (pGp)	500Units	316-Eur	Jena Bio
N-20337-1G	Nucleic acids: Arabinofuranosyl-isoguanine, 1 g pack	1g	1309-Eur	Jena Bio
N-20337-250	Nucleic acids: Arabinofuranosyl-isoguanine, 250 mg pack	250mg	580-Eur	Jena Bio
N-1062-20	Nucleic acids: 2-Thio-uridine, 20 mg pack	20mg	143-Eur	Jena Bio
N-1022	Nucleic acids: N6-benzylaminopurine riboside, 1 g pack	1g	134-Eur	Jena Bio
N-1045	Nucleic acids: 8-Oxo-2'-deoxy-guanosine (8-Oxo-dG), 25 mg pack	25mg	342-Eur	Jena Bio
NU-1126S	Nucleic acids: AppNH2, S pack (AMPPN)	150Units	128-Eur	Jena Bio
NU-1126L	Nucleic acids: AppNH2, L pack (AMPPN)	750Units	316-Eur	Jena Bio
NU-1125S	Nucleic acids: 5-Methyl-dCTP, S pack	100Units	133-Eur	Jena Bio
N-1052	Nucleic acids: N7-methyl-guanosine, 100 mg pack	100mg	186-Eur	Jena Bio
NU-1125L	Nucleic acids: 5-Methyl-dCTP, L pack	500Units	331-Eur	Jena Bio
N-1054	Nucleic acids: 6-Thio-guanosine, 1 g pack	1g	186-Eur	Jena Bio
N-1055	Nucleic acids: N1-Methyl-adenosine, 100 mg pack	100mg	134-Eur	Jena Bio
N-1057	Nucleic acids: 5-Methyl-uridine, 100 mg pack	100mg	342-Eur	Jena Bio
N-1061	Nucleic acids: 2-Azido-adenosine, 10 mg pack	10mg	132-Eur	Jena Bio
N-20338-250	Nucleic acids: 2'-Deoxy-isoguanosine, 250 mg pack	250mg	276-Eur	Jena Bio
N-20338-1G	Nucleic acids: 2'-Deoxy-isoguanosine, 1 g pack	1g	599-Eur	Jena Bio
N-20338-10G	Nucleic acids: 2'-Deoxy-isoguanosine, 10 g pack	10g	3821-Eur	Jena Bio
N-1062-100	Nucleic acids: 2-Thio-uridine, 100 mg pack	100mg	428-Eur	Jena Bio
NU-1102L	Nucleic acids: AP4 , L pack (Adenosine-5'-tetraphosphate)	500Units	316-Eur	Jena Bio
E2013Hu	Human free fatty acids,FFA ELISA Kit	96T	533-Eur	Eastbio	Elisa kits
NU-1007	Nucleic acids: dITP - solution, pack 100 mM	1ml	96-Eur	Jena Bio
NU-1193L	Nucleic acids: ZMP, L pack (AICAR monophosphate)	250Units	316-Eur	Jena Bio
NU-1189S	Nucleic acids: 4-Thio-i-propyl-UTP, S pack	20Units	128-Eur	Jena Bio
NU-1189L	Nucleic acids: 4-Thio-i-propyl-UTP, L pack	100Units	316-Eur	Jena Bio
NU-1188S	Nucleic acids: 4-Thio-n-propyl-UTP, S pack	20Units	128-Eur	Jena Bio
NU-1188L	Nucleic acids: 4-Thio-n-propyl-UTP, L pack	100Units	316-Eur	Jena Bio
NU-1187S	Nucleic acids: 4-Thio-methyl-UTP, S pack	20Units	128-Eur	Jena Bio
NU-1187L	Nucleic acids: 4-Thio-methyl-UTP, L pack	100Units	316-Eur	Jena Bio
NU-1186S	Nucleic acids: 4-Thio-ethyl-UTP, S pack	20Units	128-Eur	Jena Bio
NU-1186L	Nucleic acids: 4-Thio-ethyl-UTP, L pack	100Units	316-Eur	Jena Bio
NU-1185S	Nucleic acids: 4-Thio-i-butyl-UTP, S pack	20Units	128-Eur	Jena Bio
NU-1185L	Nucleic acids: 4-Thio-i-butyl-UTP, L pack	100Units	316-Eur	Jena Bio
NU-1182S	Nucleic acids: 7-Deaza-7-I-dGTP, S pack	50Units	128-Eur	Jena Bio
NU-1182L	Nucleic acids: 7-Deaza-7-I-dGTP, L pack	250Units	316-Eur	Jena Bio
NU-1181S	Nucleic acids: 7-Deaza-7-I-dATP, S pack	50Units	128-Eur	Jena Bio
NU-1181L	Nucleic acids: 7-Deaza-7-I-dATP, L pack	250Units	316-Eur	Jena Bio
NU-1193S	Nucleic acids: ZMP, S pack (AICAR monophosphate)	50Units	128-Eur	Jena Bio
NU-1204L	Nucleic acids: IppNHp, L pack (IMPPNP)	250Units	316-Eur	Jena Bio
NU-1204S	Nucleic acids: IppNHp, S pack (IMPPNP)	50Units	128-Eur	Jena Bio
NU-1611-5FM	Nucleic acids: 7-Propargylamino-7-deaza-dATP - 5-FAM	120	746-Eur	Jena Bio
NU-1011-100G	Nucleic acids: CTP - lyophilized, 100 g pack	100g	2514-Eur	Jena Bio
MIF0501	MIF (amino acids 1-115) Human,Recombinant, His-tag, E.coli	0.5mg	478-Eur	ATGen	recombinant
NU-150S	Nucleic acids: 5-Trifluoromethyl-dUTP, S pack	20Units	128-Eur	Jena Bio
NU-150L	Nucleic acids: 5-Trifluoromethyl-dUTP, L pack	100Units	316-Eur	Jena Bio
DNJ3001	DnaJ(Amino acids 1-376), Recombinant, E.coli	0.5mg	531-Eur	ATGen	recombinant
E14E0166	Sheep Epoxyeicosatrienoic acids ELISA, EETs		715-Eur	Blue Gene Biotech	Elisa kits
NU-149S	Nucleic acids: 7-Deaza-7-Br-dATP, S pack	50Units	128-Eur	Jena Bio
NU-149L	Nucleic acids: 7-Deaza-7-Br-dATP, L pack	250Units	316-Eur	Jena Bio
NU-127S	Nucleic acids: 8Br-GppNHp, S pack (8Br-GMPPNP)	20Units	128-Eur	Jena Bio
NU-127L	Nucleic acids: 8Br-GppNHp, L pack (8Br-GMPPNP)	100Units	316-Eur	Jena Bio
NU-126S	Nucleic acids: 8I-GppNHp, S pack (8I-GMPPNP)	20Units	128-Eur	Jena Bio
NU-126L	Nucleic acids: 8I-GppNHp, L pack (8I-GMPPNP)	100Units	316-Eur	Jena Bio
NU-122S	Nucleic acids: 5Br-dUTP (5-BrdUTP), S pack	50Units	133-Eur	Jena Bio
NU-122L	Nucleic acids: 5Br-dUTP (5-BrdUTP), L pack	250Units	331-Eur	Jena Bio
NU-1180S	Nucleic acids: 3'-Dephospho-Palmitoyl-CoA, S pack	20Units	128-Eur	Jena Bio
NU-1180L	Nucleic acids: 3'-Dephospho-Palmitoyl-CoA, L pack	100Units	316-Eur	Jena Bio
E04E0166	Rabbit Epoxyeicosatrienoic acids ELISA, EETs		689-Eur	Blue Gene Biotech	Elisa kits
E05E0166	Guinea pig Epoxyeicosatrienoic acids ELISA, EETs		689-Eur	Blue Gene Biotech	Elisa kits
E05U0003	Guinea pig w-3 unsaturated fatty acids ELISA , w-3 UFA		689-Eur	Blue Gene Biotech	Elisa kits
E06U0003	Goat w-3 unsaturated fatty acids ELISA , w-3 UFA		715-Eur	Blue Gene Biotech	Elisa kits
E06E0166	Goat Epoxyeicosatrienoic acids ELISA, EETs		715-Eur	Blue Gene Biotech	Elisa kits
E07U0003	Porcine w-3 unsaturated fatty acids ELISA , w-3 UFA		715-Eur	Blue Gene Biotech	Elisa kits
E07E0166	Porcine Epoxyeicosatrienoic acids ELISA, EETs		715-Eur	Blue Gene Biotech	Elisa kits
E08E0166	Canine Epoxyeicosatrienoic acids ELISA, EETs		715-Eur	Blue Gene Biotech	Elisa kits
E08U0003	Canine w-3 unsaturated fatty acids ELISA , w-3 UFA		715-Eur	Blue Gene Biotech	Elisa kits
E09E0166	Monkey Epoxyeicosatrienoic acids ELISA, EETs		715-Eur	Blue Gene Biotech	Elisa kits
E09U0003	Monkey w-3 unsaturated fatty acids ELISA , w-3 UFA		715-Eur	Blue Gene Biotech	Elisa kits
E11U0003	Bovine w-3 unsaturated fatty acids ELISA , w-3 UFA		715-Eur	Blue Gene Biotech	Elisa kits
E11E0166	Bovine Epoxyeicosatrienoic acids ELISA, EETs		715-Eur	Blue Gene Biotech	Elisa kits
E12U0003	Chicken w-3 unsaturated fatty acids ELISA , w-3 UFA		715-Eur	Blue Gene Biotech	Elisa kits
E12E0166	Chicken Epoxyeicosatrienoic acids ELISA, EETs		715-Eur	Blue Gene Biotech	Elisa kits
E04U0003	Rabbit w-3 unsaturated fatty acids ELISA , w-3 UFA		689-Eur	Blue Gene Biotech	Elisa kits
E03E0166	Mouse Epoxyeicosatrienoic acids ELISA, EETs		689-Eur	Blue Gene Biotech	Elisa kits
E03U0003	Mouse w-3 unsaturated fatty acids ELISA , w-3 UFA		689-Eur	Blue Gene Biotech	Elisa kits
NU-1179S	Nucleic acids: 7-Deaza-dGTP, S pack	100Units	128-Eur	Jena Bio
NU-1179L	Nucleic acids: 7-Deaza-dGTP, L pack	500Units	316-Eur	Jena Bio
NU-1178S	Nucleic acids: 7-Deaza-dGDP, S pack	100Units	128-Eur	Jena Bio
NU-1178L	Nucleic acids: 7-Deaza-dGDP, L pack	500Units	316-Eur	Jena Bio
NU-1177S	Nucleic acids: 7-Deaza-dGMP, S pack	100Units	128-Eur	Jena Bio
NU-1177L	Nucleic acids: 7-Deaza-dGMP, L pack	500Units	316-Eur	Jena Bio
NU-1176S	Nucleic acids: 7-Deaza-dAMP, S pack	100Units	128-Eur	Jena Bio
NU-1176L	Nucleic acids: 7-Deaza-dAMP, L pack	500Units	316-Eur	Jena Bio
NU-1175S	Nucleic acids: 7-Deaza-dATP, S pack	100Units	128-Eur	Jena Bio
NU-1175L	Nucleic acids: 7-Deaza-dATP, L pack	500Units	316-Eur	Jena Bio
NU-1174S	Nucleic acids: 7-Deaza-dADP, S pack	100Units	128-Eur	Jena Bio
NU-1174L	Nucleic acids: 7-Deaza-dADP, L pack	500Units	316-Eur	Jena Bio
11-MIF-HT	Antigens MIF (amino acids 1-115) Human,Recombinant, His-tag, E.coli	5	226-Eur	ARP
E01E0166	Human Epoxyeicosatrienoic acids ELISA, EETs		689-Eur	Blue Gene Biotech	Elisa kits
E01U0003	Human w-3 unsaturated fatty acids ELISA , w-3 UFA		689-Eur	Blue Gene Biotech	Elisa kits
E14U0003	Sheep w-3 unsaturated fatty acids ELISA , w-3 UFA		715-Eur	Blue Gene Biotech	Elisa kits
NU-842-25	Nucleic acids: gamma-[(8-Aminooctyl)-imido]-ITP, 25 mg pack	25mg	316-Eur	Jena Bio
NU-835-565	Nucleic acids: N6-(6-Amino)hexyl-dATP - ATTO-565	120	746-Eur	Jena Bio
NU-835-550	Nucleic acids: N6-(6-Amino)hexyl-dATP - ATTO-550	80	746-Eur	Jena Bio
NU-835-532	Nucleic acids: N6-(6-Amino)hexyl-dATP - ATTO-532	80	746-Eur	Jena Bio
NU-835-495	Nucleic acids: N6-(6-Amino)hexyl-dATP - ATTO-495	80	746-Eur	Jena Bio
NU-835-488	Nucleic acids: N6-(6-Amino)hexyl-dATP - ATTO-488	80	746-Eur	Jena Bio
NU-835-465	Nucleic acids: N6-(6-Amino)hexyl-dATP - ATTO-465	120	746-Eur	Jena Bio
NU-835-425	Nucleic acids: N6-(6-Amino)hexyl-dATP - ATTO-425	120	746-Eur	Jena Bio
NU-835-390	Nucleic acids: N6-(6-Amino)hexyl-dATP - ATTO-390	80	746-Eur	Jena Bio
NU-834S	Nucleic acids: gamma-[6-Aminohexyl]-GTP, S pack	50Units	128-Eur	Jena Bio
NU-834L	Nucleic acids: gamma-[6-Aminohexyl]-GTP, L pack	250Units	316-Eur	Jena Bio
NU-833S	Nucleic acids: gamma-[6-Aminohexyl]-ATP, S pack	50Units	128-Eur	Jena Bio
NU-833L	Nucleic acids: gamma-[6-Aminohexyl]-ATP, L pack	250Units	316-Eur	Jena Bio
NU-833-BIO	Nucleic acids: gamma-[6-Aminohexyl]-ATP - Biotin, pack	50	172-Eur	Jena Bio
NU-1108L	Nucleic acids: Guanosine-2'_5'-bisphosphate, L pack	500Units	316-Eur	Jena Bio
NU-841-25	Nucleic acids: gamma-[(8-Aminooctyl)-imido]-XTP, 25 mg pack	25mg	316-Eur	Jena Bio
NU-814-TXR	Nucleic acids: gamma-[(6-Aminohexyl)imido]-ATP - Texas Red	120	746-Eur	Jena Bio
NU-835-590	Nucleic acids: N6-(6-Amino)hexyl-dATP - ATTO-590	120	746-Eur	Jena Bio
NU-835-594	Nucleic acids: N6-(6-Amino)hexyl-dATP - ATTO-594	40	746-Eur	Jena Bio
NU-841-5	Nucleic acids: gamma-[(8-Aminooctyl)-imido]-XTP, 5 mg pack	5mg	128-Eur	Jena Bio
NU-835-TXR	Nucleic acids: N6-(6-Amino)hexyl-dATP - Texas Red	160	746-Eur	Jena Bio
NU-835-TAM	Nucleic acids: N6-(6-Amino)hexyl-dATP - 5_6-TAMRA	40	209-Eur	Jena Bio
NU-835-MNT	Nucleic acids: N6-(6-Amino)hexyl-dATP - MANT	200	746-Eur	Jena Bio
NU-835-MB2	Nucleic acids: N6-(6-Amino)hexyl-dATP - ATTO-MB2	40	746-Eur	Jena Bio
NU-835-740	Nucleic acids: N6-(6-Amino)hexyl-dATP - ATTO-740	40	746-Eur	Jena Bio
NU-835-725	Nucleic acids: N6-(6-Amino)hexyl-dATP - ATTO-725	40	746-Eur	Jena Bio
NU-835-700	Nucleic acids: N6-(6-Amino)hexyl-dATP - ATTO-700	40	746-Eur	Jena Bio
NU-835-680	Nucleic acids: N6-(6-Amino)hexyl-dATP - ATTO-680	40	746-Eur	Jena Bio
NU-835-665	Nucleic acids: N6-(6-Amino)hexyl-dATP - ATTO-665	400	746-Eur	Jena Bio
NU-835-661Q	Nucleic acids: N6-(6-Amino)hexyl-dATP - DYQ-661	40	746-Eur	Jena Bio
NU-835-660Q	Nucleic acids: N6-(6-Amino)hexyl-dATP - DYQ-660	40	746-Eur	Jena Bio
NU-835-656	Nucleic acids: N6-(6-Amino)hexyl-dATP - OYSTER-656	40	746-Eur	Jena Bio
NU-835-655	Nucleic acids: N6-(6-Amino)hexyl-dATP - ATTO-655	40	746-Eur	Jena Bio
NU-835-633	Nucleic acids: N6-(6-Amino)hexyl-dATP - ATTO-633	40	746-Eur	Jena Bio
NU-835-620	Nucleic acids: N6-(6-Amino)hexyl-dATP - ATTO-620	40	746-Eur	Jena Bio
NU-814-590	Nucleic acids: gamma-[(6-Aminohexyl)imido]-ATP - ATTO-590	120	746-Eur	Jena Bio
NU-814-565	Nucleic acids: gamma-[(6-Aminohexyl)imido]-ATP - ATTO-565	120	746-Eur	Jena Bio
NU-438S	Nucleic acids: CpCpp, S pack (CMPCPP)	100Units	133-Eur	Jena Bio
NU-438L	Nucleic acids: CpCpp, L pack (CMPCPP)	500Units	331-Eur	Jena Bio
NU-437S	Nucleic acids: dCpCpp, S pack (dCMPCPP)	50Units	133-Eur	Jena Bio
NU-437L	Nucleic acids: dCpCpp, L pack (dCMPCPP)	250Units	331-Eur	Jena Bio
NU-432S	Nucleic acids: dApCpp, S pack (dAMPCPP)	50Units	133-Eur	Jena Bio
NU-432L	Nucleic acids: dApCpp, L pack (dAMPCPP)	250Units	331-Eur	Jena Bio
NU-431S	Nucleic acids: dGpCpp, S pack (dGMPCPP)	50Units	133-Eur	Jena Bio
NU-431L	Nucleic acids: dGpCpp, L pack (dGMPCPP)	250Units	331-Eur	Jena Bio
NU-429S	Nucleic acids: dUpCpp, S pack (dUMPCPP)	50Units	133-Eur	Jena Bio
NU-429L	Nucleic acids: dUpCpp, L pack (dUMPCPP)	250Units	331-Eur	Jena Bio
NU-428S	Nucleic acids: dUpCp, S pack (dUMPCP)	100Units	128-Eur	Jena Bio
NU-428L	Nucleic acids: dUpCp, L pack (dUMPCP)	500Units	316-Eur	Jena Bio
HSP0501	HSP 90 (amino acids 1-732), Human, Recombinant, His-tag, E.coli	0.5mg	820-Eur	ATGen
HSP0501	HSP 90 (amino acids 1-732), Human, Recombinant, His-tag, E.coli	100ug	340-Eur	ATGen
NU-423S	Nucleic acids: XppCp, S pack (XMPPCP)	100Units	128-Eur	Jena Bio
E01E0166	Human Epoxyeicosatrienoic acids ELISA, EETs	96 Tests/kit	601-Eur	BGene	Elisa kits
NU-441L	Nucleic acids: CpCp, L pack (CMPCP)	750Units	316-Eur	Jena Bio
NU-441S	Nucleic acids: CpCp, S pack (CMPCP)	150Units	128-Eur	Jena Bio
NU-814-532	Nucleic acids: gamma-[(6-Aminohexyl)imido]-ATP - ATTO-532	120	746-Eur	Jena Bio
NU-814-488	Nucleic acids: gamma-[(6-Aminohexyl)imido]-ATP - ATTO-488	120	746-Eur	Jena Bio
NU-814-425	Nucleic acids: gamma-[(6-Aminohexyl)imido]-ATP - ATTO-425	120	746-Eur	Jena Bio
NU-814-3	Nucleic acids: gamma-[(6-Aminohexyl)-imido]-ATP, 3 mg pack	3mg	128-Eur	Jena Bio
NU-814-15	Nucleic acids: gamma-[(6-Aminohexyl)-imido]-ATP, 15 mg pack	15mg	316-Eur	Jena Bio
NU-810S	Nucleic acids: EDA-AppNHp, S pack (EDA-AMPPNP)	20Units	133-Eur	Jena Bio
NU-810L	Nucleic acids: EDA-AppNHp, L pack (EDA-AMPPNP)	100Units	331-Eur	Jena Bio
NU-809S	Nucleic acids: 5-Propargylamino-dCTP, S pack	30Units	128-Eur	Jena Bio
NU-809L	Nucleic acids: 5-Propargylamino-dCTP, L pack	150Units	316-Eur	Jena Bio
NU-805S	Nucleic acids: N6-(6-Amino)hexyl-ATP, S pack	50Units	128-Eur	Jena Bio
NU-805L	Nucleic acids: N6-(6-Amino)hexyl-ATP, L pack	250Units	316-Eur	Jena Bio
NU-805-BIO	Nucleic acids: N6-(6-Amino)hexyl-ATP - Biotin, pack	50	172-Eur	Jena Bio
NU-804S	Nucleic acids: N6-(4-Amino)butyl-ATP, S pack	50Units	128-Eur	Jena Bio
NU-804L	Nucleic acids: N6-(4-Amino)butyl-ATP, L pack	250Units	316-Eur	Jena Bio
NU-803S	Nucleic acids: Aminoallyl-dUTP, S pack	50Units	128-Eur	Jena Bio
NU-803L	Nucleic acids: Aminoallyl-dUTP, L pack	250Units	316-Eur	Jena Bio
E01U0003	Human w-3 unsaturated fatty acids ELISA , w-3 UFA	97 Tests/kit	601-Eur	BGene	Elisa kits
NU-842-5	Nucleic acids: gamma-[(8-Aminooctyl)-imido]-ITP, 5 mg pack	5mg	128-Eur	Jena Bio
bs-0706PB	Peptides: T4-BSA Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0219P	Peptides: HCV-NS3 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0218P	Peptides: HCV-NS1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0212P	Peptides: HEV Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1520P	Peptides: CD7 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0192P	Peptides: TrK A.B.C Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0187P	Peptides: IRS-4 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1704P	Peptides: PAI-1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0186P	Peptides: IRS-3 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1744P	Peptides: CK7 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0179P	Peptides: PSD-95 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0176P	Peptides: Trk C Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0175P	Peptides: Trk B Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0173P	Peptides: IRS-2 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0172P	Peptides: IRS-1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
E04E0166	Rabbit Epoxyeicosatrienoic acids ELISA, EETs	96 Tests/kit	601-Eur	BGene	Elisa kits
bs-0160P	Peptides: NT-3 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0227P	Peptides: IGF-1 R Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0288P	Peptides: Trk B Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0780P	Peptides: IL-8 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0673P	Peptides: B7-H4 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0830P	Peptides: Oct-4 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0842P	Peptides: c-Myc tag Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0843P	Peptides: HA tag Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0648P	Peptides: CD8 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0864P	Peptides: K3 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0647P	Peptides: CD4 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0966P	Peptides: HA tag(map) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1113P	Peptides: CD5 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1146P	Peptides: N-ras Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1170P	Peptides: FOS B Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0424P	Peptides: MMP-1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0412P	Peptides: MMP-2 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0324P	Peptides: C5 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1279P	Peptides: HLA-E Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0158P	Peptides: NT-4,NT-5 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0136P	Peptides: GTP-CH-1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-910L	Nucleic acids: 5-AcOHg-dUTP, L pack	500Units	316-Eur	Jena Bio
NU-903S	Nucleic acids: dUpNHpp, S pack (dUMPNPP)	50Units	133-Eur	Jena Bio
NU-903L	Nucleic acids: dUpNHpp, L pack (dUMPNPP)	250Units	331-Eur	Jena Bio
NU-902S	Nucleic acids: dUpNHp, S pack (dUMPNP)	100Units	128-Eur	Jena Bio
NU-902L	Nucleic acids: dUpNHp, L pack (dUMPNP)	500Units	316-Eur	Jena Bio
NU-855-5	Nucleic acids: m27.3'-OGP3G (ARCA Cap Analog), 5 mg pack	5mg	594-Eur	Jena Bio
NU-855-1	Nucleic acids: m27.3'-OGP3G (ARCA Cap Analog), 1 mg pack	1mg	182-Eur	Jena Bio
NU-854-5	Nucleic acids: GP3G (Unmethylated Cap Analog), 5 mg pack	5mg	316-Eur	Jena Bio
NU-854-1	Nucleic acids: GP3G (Unmethylated Cap Analog), 1 mg pack	1mg	128-Eur	Jena Bio
NU-853-5	Nucleic acids: m32.2.7GP3G (Trimethylated Cap Analog), 5 mg pack	5mg	362-Eur	Jena Bio
NU-853-1	Nucleic acids: m32.2.7GP3G (Trimethylated Cap Analog), 1 mg pack	1mg	128-Eur	Jena Bio
NU-852-5	Nucleic acids: m7GP3G (Monomethylated Cap Analog), 5 mg pack	5mg	316-Eur	Jena Bio
NU-852-1	Nucleic acids: m7GP3G (Monomethylated Cap Analog), 1 mg pack	1mg	128-Eur	Jena Bio
NU-847-5	Nucleic acids: gamma-[(8-Aminooctyl)-imido]-8-Oxo-GTP, 5 mg pack	5mg	316-Eur	Jena Bio
NU-847-1	Nucleic acids: gamma-[(8-Aminooctyl)-imido]-8-Oxo-GTP, 1 mg pack	1mg	128-Eur	Jena Bio
NU-844-5	Nucleic acids: gamma-[(8-Aminooctyl)-imido]-CTP, 5 mg pack	5mg	128-Eur	Jena Bio
NU-910S	Nucleic acids: 5-AcOHg-dUTP, S pack	100Units	128-Eur	Jena Bio
NU-911-1	Nucleic acids: gamma-[6-Aminohexyl]-N6-Benzyl-ATP, 1 mg pack	1mg	128-Eur	Jena Bio
bs-0133P	Peptides: PP-1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2071P	Peptides: E2 tag Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2090P	Peptides: P53(wt-p53) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2112P	Peptides: KT3 tag Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2113P	Peptides: AU5 tag Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0060P	Peptides: CEA Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0044P	Peptides: BNP Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0033P	Peptides: P53 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0032P	Peptides: Bcl-2 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
P0006	Peptides: BSA Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0019P	Peptides: OPN Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-930S	Nucleic acids: UpNHpp, S pack (UMPNPP)	50Units	133-Eur	Jena Bio
NU-930L	Nucleic acids: UpNHpp, L pack (UMPNPP)	250Units	331-Eur	Jena Bio
NU-926-BIO	Nucleic acids: gamma-PEG8-ATP - Biotin, pack	50	172-Eur	Jena Bio
NU-916-MB2	Nucleic acids: gamma-[6-Aminohexyl]-dGTP - ATTO-MB2	10	209-Eur	Jena Bio
bs-0018P	Peptides: IDE Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-844-25	Nucleic acids: gamma-[(8-Aminooctyl)-imido]-CTP, 25 mg pack	25mg	316-Eur	Jena Bio
E03E0166	Mouse Epoxyeicosatrienoic acids ELISA,EETs	96 Tests/kit	601-Eur	BGene	Elisa kits
Z02528	Retinoblastoma Protein (amino acids 773_928)	500ug	342-Eur	Genscript
NU-215L	Nucleic acids: Mant-ITPgammaS, L pack	50Units	316-Eur	Jena Bio
E0612m	Mouse free fatty acids ELISA Kit	96T	739-Eur	EIAab	elisa
U0612h	Human free fatty acids CLIA KIT	96T	706-Eur	EIAab	assays
NU-215S	Nucleic acids: Mant-ITPgammaS, S pack	10Units	128-Eur	Jena Bio
NU-216L	Nucleic acids: Mant-N6-Methyl-ATP, L pack	150Units	316-Eur	Jena Bio
NU-216S	Nucleic acids: Mant-N6-Methyl-ATP, S pack	30Units	128-Eur	Jena Bio
NU-218L	Nucleic acids: TNP-GppNHp, L pack (TNP-GMPPNP)	0,5	331-Eur	Jena Bio
NU-218S	Nucleic acids: TNP-GppNHp, S pack (TNP-GMPPNP)	0,1	133-Eur	Jena Bio
E0612h	Human free fatty acids ELISA Kit	96T	706-Eur	EIAab	elisa
XC-E1154/500	MEM non Essential Amino Acids 100X w_o L_Glutamine _ 500 ml	500 ml	71-Eur	Biosera
CSB-E08769h	Human free fatty acids,FFA ELISA Kit	96T	856-Eur	Cusabio	elisa
CSB-E08771m	Mouse free fatty acids,FFA ELISA Kit	96T	915-Eur	Cusabio	elisa
CSB-E13180p	Porcine Free Fatty Acids(FFA) ELISA Kit	96T	972-Eur	Cusabio	elisa
XC-E1154/100	MEM non Essential Amino Acids 100X w_o L_Glutamine _ 100 ml	100 ml	71-Eur	Biosera
NU-209L	Nucleic acids: Mant-GTPgammaS, L pack	50Units	331-Eur	Jena Bio
NU-209S	Nucleic acids: Mant-GTPgammaS, S pack	10Units	133-Eur	Jena Bio
NU-212L	Nucleic acids: Mant-dGTP, L pack	250Units	331-Eur	Jena Bio
NU-212S	Nucleic acids: Mant-dGTP, S pack	50Units	133-Eur	Jena Bio
U0612m	Mouse free fatty acids CLIA KIT	96T	739-Eur	EIAab	assays
E01U0003	Human Anti-w-3 unsaturated fatty acids	96 Tests/kit	1087-Eur	BlueGen	human
10-002-38023	Hsp104 (amino acids 1-908) Saccharomyces cerevisiae - N_A N_A	1 mg	1199-Eur	GenWay
E03U0003	Mouse w-3 unsaturated fatty acids ELISA	96T/kit	692-Eur	Blue Gene Biotech	Elisa kits
SL0225Mo	Mouse free fatty acids,FFA ELISA Kit	96T	573-Eur	Sunlog	Elisa kits
E09U0003	Monkey w-3 unsaturated fatty acids ELISA	96T/kit	717-Eur	Blue Gene Biotech	Elisa kits
E01U0003	Human w-3 unsaturated fatty acids ELISA	96T/kit	692-Eur	Blue Gene Biotech	Elisa kits
SL0730Hu	Human free fatty acids,FFA ELISA Kit	96T	531-Eur	Sunlog	Elisa kits
E05U0003	Guinea Pig w-3 unsaturated fatty acids ELISA	96T/kit	708-Eur	Blue Gene Biotech	Elisa kits
E06U0003	Goat w-3 unsaturated fatty acids ELISA	96T/kit	708-Eur	Blue Gene Biotech	Elisa kits
E12U0003	Chicken w-3 unsaturated fatty acids ELISA	96T/kit	717-Eur	Blue Gene Biotech	Elisa kits
E07U0003	Porcine w-3 unsaturated fatty acids ELISA	96T/kit	708-Eur	Blue Gene Biotech	Elisa kits
NU-223S	Nucleic acids: 2'-Mant-3'-dATP, S pack	20Units	128-Eur	Jena Bio
NU-223L	Nucleic acids: 2'-Mant-3'-dATP, L pack	100Units	316-Eur	Jena Bio
FA115	NEFA (Non-Esterified Fatty Acids) COLORIMETRIC	R1 3x10, R2 3x20	265-Eur	RANDOX
23689	Mouse free fatty acids(FFA) ELISA Kit	96T	878-Eur	Bio-Medical	elisa
06344-14	MEM Non‐Essential Amino Acids Solution(100x)	20ML	115-Eur	Nacala
06344-56	MEM Non‐Essential Amino Acids Solution(100x)	100ML	126-Eur	Nacala
SP-69627-1	VIP, human, porcine, rat; VIP (28 amino acids) (AA: His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2) (MW: 3225.7)	1 mg	304-Eur	ADI
E14U0003	Sheep w-3 unsaturated fatty acids ELISA	96T/kit	717-Eur	Blue Gene Biotech	Elisa kits
E04U0003	Rabbit w-3 unsaturated fatty acids ELISA	96T/kit	692-Eur	Blue Gene Biotech	Elisa kits
E08U0003	Canine w-3 unsaturated fatty acids ELISA	96T/kit	708-Eur	Blue Gene Biotech	Elisa kits
NU-1619-655	Nucleic acids: 5-Propargylamino-ddUTP - ATTO-655	80	746-Eur	Jena Bio
NU-1619-MNT	Nucleic acids: 5-Propargylamino-ddUTP - MANT	200	746-Eur	Jena Bio
NU-1619-TAM	Nucleic acids: 5-Propargylamino-ddUTP - 5_6-TAMRA	60	209-Eur	Jena Bio
NU-1619-TXR	Nucleic acids: 5-Propargylamino-ddUTP - Texas Red	240	746-Eur	Jena Bio
ABS6669	RECOMBINANT HUMAN INTERLEUKIN_8 (72 AMINO ACIDS)	25 µg	392-Eur	AbD	recombinant
NU-1701L	Nucleic acids: gamma-[2-Azidoethyl]-ATP, L pack	500units	316-Eur	Jena Bio
ABS6888	RECOMBINANT HUMAN INTERLEUKIN_8 (77 AMINO ACIDS)	25 µg	242-Eur	AbD	recombinant
NU-1701S	Nucleic acids: gamma-[2-Azidoethyl]-ATP, S pack	100Units	128-Eur	Jena Bio
NU-1702L	Nucleic acids: gamma-[6-Azidohexyl]-ATP, L pack	250Units	316-Eur	Jena Bio
NU-1619-MB2	Nucleic acids: 5-Propargylamino-ddUTP - ATTO-MB2	80	746-Eur	Jena Bio
NU-1619-DIGX	Nucleic acids: DIG-11-ddUTP, pack	25	152-Eur	Jena Bio
NU-1619-656	Nucleic acids: 5-Propargylamino-ddUTP - OYSTER-656	80	746-Eur	Jena Bio
NU-1619-660Q	Nucleic acids: 5-Propargylamino-ddUTP - DYQ-660	80	746-Eur	Jena Bio
NU-1619-661Q	Nucleic acids: 5-Propargylamino-ddUTP - DYQ-661	80	746-Eur	Jena Bio
NU-1619-665	Nucleic acids: 5-Propargylamino-ddUTP - ATTO-665	400	746-Eur	Jena Bio
NU-1619-680	Nucleic acids: 5-Propargylamino-ddUTP - ATTO-680	80	746-Eur	Jena Bio
NU-1619-700	Nucleic acids: 5-Propargylamino-ddUTP - ATTO-700	80	746-Eur	Jena Bio
NU-1619-725	Nucleic acids: 5-Propargylamino-ddUTP - ATTO-725	80	746-Eur	Jena Bio
NU-1619-740	Nucleic acids: 5-Propargylamino-ddUTP - ATTO-740	80	746-Eur	Jena Bio
NU-1702S	Nucleic acids: gamma-[6-Azidohexyl]-ATP, S pack	50Units	128-Eur	Jena Bio
NU-203L	Nucleic acids: Mant-dATP, L pack	250Units	331-Eur	Jena Bio
NU-203S	Nucleic acids: Mant-dATP, S pack	50Units	133-Eur	Jena Bio
B-003-22	Nesfatin_1 (Rat) (82 amino acids) _ Biotin Labeled _ 10ug	10 µg	692-Eur	Phoenix Peptide	labeled
NU-205S	Nucleic acids: Mant-dGDP, S pack	30Units	133-Eur	Jena Bio
FC3-003-26	Nesfatin_1 (Human) (82 amino acids) _ Cy3 Labeled _ 1 nmol	1 nmol	763-Eur	Phoenix Peptide	labeled
FC5-003-26	Nesfatin_1 (Human) (82 amino acids) _ Cy5 Labeled _ 1 nmol	1 nmol	763-Eur	Phoenix Peptide	labeled
FG-003-22B	Nesfatin_1 (Rat) (82 amino acids) _ FITC Labeled _ 1 nmol	1 nmol	692-Eur	Phoenix Peptide	labeled
FG-003-26A	Nesfatin_1 (Human) (82 amino acids) _ FAM Labeled _ 1 nmol	1 nmol	622-Eur	Phoenix Peptide	labeled
LIP	Lipolysis Assay KIT, Free Fatty Acids Detection	kit	3922-Eur	ZenBio	elisa
CSB-E08771m	Mouse free fatty acids,FFA ELISA Kit	96tests	856-Eur	Cusabio	elisa
CSB-E13180p	Porcine Free Fatty Acids(FFA) ELISA Kit	96tests	972-Eur	Cusabio	elisa
CSB-E08771m	Mouse free fatty acids,FFA ELISA Kit	96tests	915-Eur	Cusabio	elisa
SP-69627-1	VIP, human, porcine, rat; VIP (28 amino acids) (AA His_Ser_Asp_Ala_Val_Phe_Thr_Asp_Asn_Tyr_Thr_Arg_Leu_Arg_Lys_Gln_Met_Ala_Val_Lys_Lys_Tyr_Leu_Asn_Ser_Ile_Leu_Asn_NH2) (MW 3225.7)	1 mg	335-Eur	Alpha Dia	human
CA012-010	MEM Non-Essential Amino Acids Solution 10 mM (100X),	100ml	61-Eur	GenDepot
BQ 092A-EALD	Total Bile Acids (TBA) (Colorimetric) Kit	600/kit	501-Eur	Bioquant	assays
NU-205L	Nucleic acids: Mant-dGDP, L pack	150Units	331-Eur	Jena Bio
XC-B1150/100	BME Amino Acids 100X w_o L_Glutamine _ 100ml		46-Eur	Biosera
CSB-E08769h	Human free fatty acids,FFA ELISA Kit	96tests	856-Eur	Cusabio	elisa
CSB-E13180p	Porcine Free Fatty Acids(FFA) ELISA Kit	96tests	913-Eur	Cusabio	elisa
CSB-E08769h	Human free fatty acids,FFA ELISA Kit	96tests	856-Eur	Cusabio	elisa
LIP	Lipolysis Treatment Screening KIT (free fatty acids)	kit	1114-Eur	ZenBio	assays
E11U0003	Bovine w-3 unsaturated fatty acids ELISA	96T/kit	717-Eur	Blue Gene Biotech	Elisa kits
E07U0003	Porcine w-3 unsaturated fatty acids ELISA , w-3 UFA	97 Tests/kit	608-Eur	BGene	Elisa kits
NU-415L	Nucleic acids: UppNHp, L pack (UMPPNP)	500Units	316-Eur	Jena Bio
CSB-EQ027300CH	Chicken free fatty acids(FFA) ELISA kit	96T	710-Eur	Cusabio	Elisa kits
QY-E00400	Human free fatty acids(FFA)ELISA Kit	96T	464-Eur	SQBIO	Elisa kits
E09E0166	Monkey Epoxyeicosatrienoic acids ELISA, EETs	96 Tests/kit	622-Eur	BGene	Elisa kits
NU-423L	Nucleic acids: XppCp, L pack (XMPPCP)	500Units	316-Eur	Jena Bio
NU-420S	Nucleic acids: ApCp, S pack (AMPCP)	150Units	128-Eur	Jena Bio
NU-415S	Nucleic acids: UppNHp, S pack (UMPPNP)	100Units	128-Eur	Jena Bio
CK-E20248	Mouse free fatty acids,FFA ELISA Kit	96T	454-Eur	Eastbio	Elisa kits
NU-420L	Nucleic acids: ApCp, L pack (AMPCP)	750Units	316-Eur	Jena Bio
NU-405S	Nucleic acids: GpCpp, S pack (GMPCPP)	100Units	133-Eur	Jena Bio
201-12-2014	Human free fatty acids(FFA)ELISA Kit	96T	602-Eur	SunBT	Elisa kits
NU-403L	Nucleic acids: XppNHp, L pack (XMPPNP)	250Units	316-Eur	Jena Bio
E12U0003	Chicken w-3 unsaturated fatty acids ELISA , w-3 UFA	96 Tests/kit	622-Eur	BGene	Elisa kits
NU-414S	Nucleic acids: GpCp, S pack (GMPCP)	150Units	128-Eur	Jena Bio
E07E0166	Porcine Epoxyeicosatrienoic acids ELISA, EETs	96 Tests/kit	608-Eur	BGene	Elisa kits
NU-405L	Nucleic acids: GpCpp, L pack (GMPCPP)	500Units	331-Eur	Jena Bio
E14E0166	Sheep Epoxyeicosatrienoic acids ELISA, EETs	96 Tests/kit	622-Eur	BGene	Elisa kits
E14U0003	Sheep w-3 unsaturated fatty acids ELISA , w-3 UFA	97 Tests/kit	622-Eur	BGene	Elisa kits
E06U0003	Goat w-3 unsaturated fatty acids ELISA , w-3 UFA	97 Tests/kit	608-Eur	BGene	Elisa kits
E08E0166	Canine Epoxyeicosatrienoic acids ELISA, EETs	96 Tests/kit	622-Eur	BGene	Elisa kits
E09U0003	Monkey w-3 unsaturated fatty acids ELISA , w-3 UFA	97 Tests/kit	622-Eur	BGene	Elisa kits
E06E0166	Goat Epoxyeicosatrienoic acids ELISA, EETs	96 Tests/kit	608-Eur	BGene	Elisa kits
E08U0003	Canine w-3 unsaturated fatty acids ELISA , w-3 UFA	97 Tests/kit	622-Eur	BGene	Elisa kits
NU-414L	Nucleic acids: GpCp, L pack (GMPCP)	750Units	316-Eur	Jena Bio
CA012-010	MEM Non-Essential Amino Acids Solution 10 mM (100X),	100ml x 5	61-Eur	GenDepot
NU-403S	Nucleic acids: XppNHp, S pack (XMPPNP)	50Units	128-Eur	Jena Bio
QY-E20610	Mouse free fatty acids(FFA)ELISA Kit	96T	464-Eur	SQBIO	Elisa kits
QY-E20611	Mouse free KXtty acids(FKX)ELISA Kit	96T	464-Eur	SQBIO	Elisa kits
CK-E96643	Human free fatty acids,FFA ELISAkit		----Eur	Glory	Elisa kits
E03U0003	Mouse w-3 unsaturated fatty acids ELISA ,w-3 UFA	97 Tests/kit	601-Eur	BGene	Elisa kits
E11U0003	Bovine w-3 unsaturated fatty acids ELISA , w-3 UFA	97 Tests/kit	622-Eur	BGene	Elisa kits
CK-E95653	Human free fatty acids (FFA) ELISA Kit	96T	728-Eur	Glory	Elisa kits
CK-E95654	Human free fatty acids (FFA) ELISA Kit	96T	728-Eur	Glory	Elisa kits
E12E0166	Chicken Epoxyeicosatrienoic acids ELISA, EETs	96 Tests/kit	622-Eur	BGene	Elisa kits
CK-E97745	Mouse free fatty acids,FFA ELISAkit		----Eur	Glory	Elisa kits
E0620Mo	Mouse free fatty acids,FFA ELISA Kit	48T	386-Eur	JING	Elisa kits
YHB0549Mo	Mouse free fatty acids,FFA ELISA Kit	96T	633-Eur	yehua	Elisa kits
YHB1249Hu	Human free fatty acids,FFA ELISA Kit	48T	347-Eur	yehua	Elisa kits
201-02-0622	Mouse free fatty acids(FFA)ELISA Kit	96T	548-Eur	Sunred	Elisa kits
NU-810-BIO	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - Biotin, pack	25	172-Eur	Jena Bio
YHB0549Mo	Mouse free fatty acids,FFA ELISA Kit	48T	373-Eur	yehua	Elisa kits
YHB1249Hu	Human free fatty acids,FFA ELISA Kit	96T	552-Eur	yehua	Elisa kits
E04U0003	Rabbit w-3 unsaturated fatty acids ELISA , w-3 UFA	97 Tests/kit	601-Eur	BGene	Elisa kits
CK-E10837	Human free fatty acids,FFA ELISA Kit	96T	728-Eur	Eastbio	Elisa kits
QY-E70134	Canine free KXtty acids,FKX ELISA KIT	96T	555-Eur	Qayee	Elisa kits
NU-231L	Nucleic acids: 2'-Mant-3'-dGTP, L pack	50Units	316-Eur	Jena Bio
E0621Mo	Mouse free fatty acids,FFA ELISA Kit	48T	379-Eur	Sunlog	Elisa kits
NU-231S	Nucleic acids: 2'-Mant-3'-dGTP, S pack	10Units	128-Eur	Jena Bio
NU-232L	Nucleic acids: Mant-ATPgammaS, L pack	100Units	316-Eur	Jena Bio
E11E0166	Bovine Epoxyeicosatrienoic acids ELISA, EETs	96 Tests/kit	622-Eur	BGene	Elisa kits
NU-232S	Nucleic acids: Mant-ATPgammaS, S pack	20Units	128-Eur	Jena Bio
bs-0904P-HRP	Proteins: Melamine_HRP Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-0399P	Peptides: Deltex-1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0405P	Peptides: EGFR- V III Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1109L	Nucleic acids: 6-Chlorpurine-riboside-5'-triphosphate, L pack	500Units	316-Eur	Jena Bio
NU-1611-680	Nucleic acids: 7-Propargylamino-7-deaza-dATP - ATTO-680	40	746-Eur	Jena Bio
bs-0448P	Peptides: NIS(Na+_I-symporter;NIS) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0467P	Peptides: Ghrelin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0395P	Peptides: CD133 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0431P	Peptides: OPG(Osteoprotegerin) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0409P	Peptides: Leptin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1109S	Nucleic acids: 6-Chlorpurine-riboside-5'-triphosphate, S pack	100Units	128-Eur	Jena Bio
bs-0398P	Peptides: Annexin V Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0392P	Peptides: TP-5(Thymopentin) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0287P	Peptides: HisX6 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0283P	Peptides: OVA (ovalbumin) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0282P	Peptides: Cyclin C Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0276P	Peptides: SSB_La Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0275P	Peptides: Bassoon(BSN) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0274P	Peptides: C-Peptide( C-PEP ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0273P	Peptides: PBEF (CT) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0243P	Peptides: EXPB-2 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0289P	Peptides: neurofasciu-155 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0291P	Peptides: THY (thyroglobulin,TG) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0383P	Peptides: NPY ( Neuropeptide Y)1-36 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0379P	Peptides: IL-6(Interleukin-6) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0378P	Peptides: Runx3 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-10507-G-10	Nucleic acids: 2'-Fluoro-2'-deoxy-ara-guanosine-5'-triphosphate, 10	10	475-Eur	Jena Bio
bs-0372P	Peptides: NT5C2 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2372P	Proteins: rHBsAg Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-0269P	Peptides: FoxP3 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0306P	Peptides: VTG(vitellogenin) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0241P	Peptides: HIV gp120 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0737P	Peptides: HIF-1Alpha Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-10507-U-10	Nucleic acids: 2'-Fluoro-2'-deoxy-ara-uridine-5'-triphosphate, 10	10	475-Eur	Jena Bio
MIF0501	Hormones & Cytokines: MIF (amino acids 1-115) Human, His-tag, E.coli	100ug	226-Eur	ATGen
MIF0501	Hormones & Cytokines: MIF (amino acids 1-115) Human, His-tag, E.coli	0.5mg	478-Eur	ATGen
bs-0646P	Peptides: CD34 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0645P	Peptides: sIgA Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-4533PB	Proteins: Estradiol_BSA Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-0642P	Peptides: MADCAM-1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0637P	Peptides: p38 MAPK_MKK3_MAPKK14 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0623P	Peptides: cyclin D1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0615P	Peptides: Survivin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
A8507-100G	Culture Media: Casamino Acids Bacteriological	100G	85-Eur	Biomatic
bs-0649P	Peptides: CD68 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
A8507-500G	Culture Media: Casamino Acids Bacteriological	500G	137-Eur	Biomatic
bs-0725P	Peptides: ER-alpha Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0721P	Peptides: Galectin-3 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0717P	Peptides: SPAG5_map126 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0167P	Peptides: Apo-E (Apolipoprotein E) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0698P	Peptides: IL-10(Interleukin-10) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0694P	Peptides: NRP-2(neuropilin-2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0693P	Peptides: NRP-1(neuropilin-1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0669P	Peptides: PSCA Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0666P	Peptides: Fibronectin (FN) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0655P	Peptides: PAK7_PAK5_MBT Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0608P	Peptides: CD54_ICAM-1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0604P	Peptides: galectin 9 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0599P	Peptides: E2F1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0534P	Peptides: P19ARF Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0531P	Peptides: Matriptase Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0528P	Peptides: CD24 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0526P	Peptides: 5-LOX (5-lipoxygenase) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0525P	Peptides: TM(Thrombomodulin) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0523P	Peptides: Sox2 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0521P	Peptides: CD44 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0490P	Peptides: PP2Ac Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2000Pr	Proteins: rHBcAg Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-0484P	Peptides: Lumbrokinase Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0539P	Peptides: CGA(Chromogranin A) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0543P	Peptides: CGB(Chromogranin B) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0547P	Peptides: Endostatin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0587P	Peptides: Ang- II (Angiotensin II ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0581P	Peptides: IL-4(Interleukin-4) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0576P	Peptides: Annexin II Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0573P	Peptides: Cyclin E Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0572P	Peptides: Cyclin B1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0571P	Peptides: Cyclin A Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0565P	Peptides: VEGFR2 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0563P	Peptides: P-GP(P-glycoprotein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0561P	Peptides: P-selectin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0560P	Peptides: IL-13(Interleukin-13) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0471P	Peptides: Adiponectin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0233P	Peptides: Telomerase (TE) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0069P	Peptides: NKA(Neurokinin A) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2052P	Proteins: TRF(transferrin) Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-0030P	Peptides: PP-2B alpha 1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0026P	Peptides: OPN(osteopontin) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0025P	Peptides: PS-1，Presennillin-1(CT) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0697P	Proteins: c-phycocyanin(C-PC) Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
NU-1123S	Nucleic acids: 3'-dATP, S pack (Cordycepin triphosphate)	50Units	128-Eur	Jena Bio
bs-0022P	Peptides: MAPK-1_2 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0021P	Peptides: ERAB Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0045P	Peptides: AT (Angiotenogen) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0049P	Peptides: Caspase-9 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0050P	Peptides: Caspase-9 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0067P	Peptides: NGF- Beta Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0063P	Peptides: CT (Calcitonin ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0062P	Peptides: CR (Calretinin) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2182PBG	Proteins: Melamine_Bov IgG Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-0057P	Peptides: Amylin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0056P	Peptides: Isulin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0055P	Peptides: ART(Artemin) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0053P	Peptides: Caspase-13 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CSA-100	SiMax™ Plasmid DNA Miniprep Nucleic Acids Isolation & Purification	100 preps	139-Eur	SBS
CSC-100	SiMax™ Genomic DNA Extraction Nucleic Acids Isolation & Purification	100 preps	168-Eur	SBS
NU-1123L	Nucleic acids: 3'-dATP, L pack (Cordycepin triphosphate)	250Units	316-Eur	Jena Bio
bs-0008P	Peptides: Nestin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0007P	Peptides: AM (Adrenomedullin; ADM) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0006P	Peptides: Nestin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-4813P	Proteins: H5N1-H5 Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-0971PA	Proteins: chloramphenicol_OVA Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
GWB-8D66B3	RECOMBINANT HUMAN DEFENSIN BETA 1 (36 AMINO ACIDS)		461-Eur	GenWay
bs-0774P	Proteins: mouse IgA Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
NU-1118S	Nucleic acids: 5-Aza-dCTP, S pack (Decitabine triphosphate)	20Units	133-Eur	Jena Bio
bs-0010P	Peptides: Gastrin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0013P	Peptides: Cytochrome C Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0017P	Peptides: Galanin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0971PB	Proteins: chloramphenicol_BSA Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-2182PB	Proteins: Melamine_BSA Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-0904PB	Proteins: Melamine_BSA Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-0311PB	Proteins: Biotin_BSA Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-0311PK	Proteins: Biotin_KLH Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-4545PK	Proteins: Ractopamine_KLH Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-0904PK	Proteins: Melamine_KLH Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-4545PB	Proteins: Ractopamine_BSA Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
NU-1118L	Nucleic acids: 5-Aza-dCTP, L pack (Decitabine triphosphate)	100Units	331-Eur	Jena Bio
bs-0070P	Peptides: NKB (Neurokinins B) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0232P	Peptides: PDGF-R-B Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0202P	Peptides: Endothelin-1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0200P	Peptides: PACAP-38 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0196P	Peptides: PDGF-A Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0188P	Peptides: Endothelin-1 (ET-1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0437P	Proteins: Streptavidin, SA Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-0185P	Peptides: PDGF-B Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0178P	Peptides: Nurr1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0065P	Peptides: SP (Substance P) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0209P	Peptides: CD133 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0213P	Peptides: HCV-NS4a Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0215P	Peptides: FAS (Apo-a1; CD95;) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0231P	Peptides: PDGF-R-A Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
BI3863	BILE ACIDS (Liquid) COLORIMETRIC 5th GEN. (RX daytona RX imola)	R1 2x18, R2 2x8	492-Eur	RANDOX
bs-0223P	Peptides: MAPKK2 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0221P	Peptides: HCV-Core Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-10507-C-10	Nucleic acids: 2'-Fluoro-2'-deoxy-ara-cytidine-5'-triphosphate, 10	10	475-Eur	Jena Bio
NU-10507-A-10	Nucleic acids: 2'-Fluoro-2'-deoxy-ara-adenosine-5'-triphosphate, 10	10	475-Eur	Jena Bio
bs-0217P	Peptides: bFGF Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0216P	Peptides: FasL Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0954P	Proteins: ET-1(Endothelin-1) Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-0161P	Peptides: NGF-R(p75NTR) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0152P	Peptides: Tranthyretin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0092P	Peptides: Caspase-10 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0091P	Peptides: CA125 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0088P	Peptides: Secretin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0085P	Peptides: GLP-1 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0084P	Peptides: Caspase-6 (NT) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0080P	Peptides: CD20 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0075P	Peptides: Nociceptin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0073P	Peptides: NTN (Neurturin) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0095P	Peptides: Calponin 1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0108P	Peptides: Leptin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0114P	Peptides: Aromatase Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0151P	Peptides: Caspase-6 (CT) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0134P	Peptides: Nogo-A Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0129P	Peptides: Nogo R Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0127P	Peptides: Bax peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0126P	Peptides: HSP-70 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0125P	Peptides: c-erbB-2 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0123P	Peptides: NK-2R peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0115P	Peptides: Akt_PKB Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0071P	Peptides: NPY ( Neuropeptide Y) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0741P	Peptides: p21_WAF1_CIP1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1612-594	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - ATTO-594	80	746-Eur	Jena Bio
NU-1611-661Q	Nucleic acids: 7-Propargylamino-7-deaza-dATP - DYQ-661	40	746-Eur	Jena Bio
NU-1611-660Q	Nucleic acids: 7-Propargylamino-7-deaza-dATP - DYQ-660	40	746-Eur	Jena Bio
NU-1611-656	Nucleic acids: 7-Propargylamino-7-deaza-dATP - OYSTER-656	40	746-Eur	Jena Bio
NU-1611-655	Nucleic acids: 7-Propargylamino-7-deaza-dATP - ATTO-655	40	746-Eur	Jena Bio
NU-1611-633	Nucleic acids: 7-Propargylamino-7-deaza-dATP - ATTO-633	40	746-Eur	Jena Bio
NU-1611-620	Nucleic acids: 7-Propargylamino-7-deaza-dATP - ATTO-620	40	746-Eur	Jena Bio
NU-1611-594	Nucleic acids: 7-Propargylamino-7-deaza-dATP - ATTO-594	40	746-Eur	Jena Bio
NU-1611-590	Nucleic acids: 7-Propargylamino-7-deaza-dATP - ATTO-590	80	746-Eur	Jena Bio
NU-1611-565	Nucleic acids: 7-Propargylamino-7-deaza-dATP - ATTO-565	80	746-Eur	Jena Bio
NU-1611-550	Nucleic acids: 7-Propargylamino-7-deaza-dATP - ATTO-550	40	746-Eur	Jena Bio
NU-1611-532-XX	Nucleic acids: 7-Propargylamino-7-deaza-dATP - ATTO-532-XX	40	746-Eur	Jena Bio
NU-1611-532	Nucleic acids: 7-Propargylamino-7-deaza-dATP - ATTO-532	40	746-Eur	Jena Bio
NU-1611-495	Nucleic acids: 7-Propargylamino-7-deaza-dATP - ATTO-495	40	746-Eur	Jena Bio
NU-1611-488	Nucleic acids: 7-Propargylamino-7-deaza-dATP - ATTO-488	80	746-Eur	Jena Bio
NU-1611-465	Nucleic acids: 7-Propargylamino-7-deaza-dATP - ATTO-465	80	746-Eur	Jena Bio
NU-1611-425	Nucleic acids: 7-Propargylamino-7-deaza-dATP - ATTO-425	80	746-Eur	Jena Bio
NU-1611-665	Nucleic acids: 7-Propargylamino-7-deaza-dATP - ATTO-665	400	746-Eur	Jena Bio
NU-1611-700	Nucleic acids: 7-Propargylamino-7-deaza-dATP - ATTO-700	40	746-Eur	Jena Bio
NU-1612-590	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - ATTO-590	160	746-Eur	Jena Bio
NU-1612-565	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - ATTO-565	160	746-Eur	Jena Bio
NU-1612-550	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - ATTO-550	80	746-Eur	Jena Bio
NU-1612-532	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - ATTO-532	80	746-Eur	Jena Bio
NU-1612-495	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - ATTO-495	80	746-Eur	Jena Bio
NU-1612-488	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - ATTO-488	80	746-Eur	Jena Bio
NU-1612-465	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - ATTO-465	160	746-Eur	Jena Bio
NU-1612-425	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - ATTO-425	160	746-Eur	Jena Bio
NU-1612-390	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - ATTO-390	160	746-Eur	Jena Bio
NU-1612-1	Nucleic acids: 7-Deaza-7-propargylamino-ddATP, 1 mg pack	1mg	601-Eur	Jena Bio
NU-1611-TXR	Nucleic acids: 7-Propargylamino-7-deaza-dATP - Texas Red	120	746-Eur	Jena Bio
NU-1611-TAM	Nucleic acids: 7-Propargylamino-7-deaza-dATP - 5_6-TAMRA	240	746-Eur	Jena Bio
NU-1611-MNT	Nucleic acids: 7-Propargylamino-7-deaza-dATP - MANT	100	746-Eur	Jena Bio
NU-1611-MB2	Nucleic acids: 7-Propargylamino-7-deaza-dATP - ATTO-MB2	400	746-Eur	Jena Bio
NU-1611-740	Nucleic acids: 7-Propargylamino-7-deaza-dATP - ATTO-740	40	746-Eur	Jena Bio
NU-1611-725	Nucleic acids: 7-Propargylamino-7-deaza-dATP - ATTO-725	40	746-Eur	Jena Bio
NU-1611-390	Nucleic acids: 7-Propargylamino-7-deaza-dATP - ATTO-390	80	746-Eur	Jena Bio
NU-1611-1	Nucleic acids: 7-Deaza-7-propargylamino-dATP, pack	1,84	505-Eur	Jena Bio
NU-817L	Nucleic acids: gamma-[(8-Aminooctyl)-imido]-GTP, L pack	500Units	316-Eur	Jena Bio
NU-846-5	Nucleic acids: alpha-[(6-Aminohexyl)-imido]-dCMP, 5 mg pack	5mg	128-Eur	Jena Bio
NU-848-25	Nucleic acids: gamma-[(8-Aminooctyl)-imido]-dCTP, 25 mg pack	25mg	316-Eur	Jena Bio
NU-848-5	Nucleic acids: gamma-[(8-Aminooctyl)-imido]-dCTP, 5 mg pack	5mg	128-Eur	Jena Bio
NU-849-25	Nucleic acids: gamma-[(6-Aminohexyl)-imido]-dGTP, 5 mg pack	25mg	316-Eur	Jena Bio
NU-849-5	Nucleic acids: gamma-[(6-Aminohexyl)-imido]-dGTP, 5 mg pack	5mg	128-Eur	Jena Bio
NU-916L	Nucleic acids: gamma-[6-Aminohexyl]-dGTP, L pack	250Units	316-Eur	Jena Bio
NU-916S	Nucleic acids: gamma-[6-Aminohexyl]-dGTP, S pack	50Units	128-Eur	Jena Bio
Y-0198P	Peptides: Nogo-66 1-40 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
Y-0184	Peptides: ADM (Adrenomedullin)(22-52) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
Y-0183	Peptides: ADM (Adrenomedullin)(22-42) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
Y-0067	Peptides: Leupeptin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bsF-0972	Peptides: Gentamicin_FITC Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bsb-0044P	Peptides: BNP_Biotin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-4938P	Peptides: SDF-1_CXCL12 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-4687P	Peptides: AMH_MIS Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-4609P	Peptides: CD105_Endoglin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-846-25	Nucleic acids: alpha-[(6-Aminohexyl)-imido]-dCMP, 25 mg pack	25mg	316-Eur	Jena Bio
NU-845-5	Nucleic acids: alpha-[(6-Aminohexyl)-imido]-dGMP, 5 mg pack	5mg	128-Eur	Jena Bio
bs-0128P	Peptides: PI3K Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-234L	Nucleic acids: 2-Aminopurine-riboside-5'-triphosphate, L pack	100Units	316-Eur	Jena Bio
NU-813-25	Nucleic acids: gamma-[(6-Aminohexyl)-imido]-dUTP, 25 mg pack	25mg	316-Eur	Jena Bio
NU-813-5	Nucleic acids: gamma-[(6-Aminohexyl)-imido]-dUTP, 5 mg pack	5mg	128-Eur	Jena Bio
NU-814-BIO	Nucleic acids: gamma-[(6-Aminohexyl)-imido]-ATP - Biotin, pack	50	172-Eur	Jena Bio
NU-815L	Nucleic acids: gamma-[(8-Aminooctyl)-imido]-ATP, L pack	500Units	316-Eur	Jena Bio
NU-815S	Nucleic acids: gamma-[(8-Aminooctyl)-imido]-ATP, S pack	100Units	128-Eur	Jena Bio
NU-816L	Nucleic acids: gamma-[(6-Aminohexyl)-imido]-GTP, L pack	500Units	316-Eur	Jena Bio
NU-816S	Nucleic acids: gamma-[(6-Aminohexyl)-imido]-GTP, S pack	100Units	128-Eur	Jena Bio
NU-817S	Nucleic acids: gamma-[(8-Aminooctyl)-imido]-GTP, S pack	100Units	128-Eur	Jena Bio
NU-818-25	Nucleic acids: gamma-[(8-Aminooctyl)-imido]-dUTP, 25 mg pack	25mg	316-Eur	Jena Bio
NU-818-5	Nucleic acids: gamma-[(8-Aminooctyl)-imido]-dUTP, 5 mg pack	5mg	128-Eur	Jena Bio
NU-835-BIO	Nucleic acids: N6-(6-Amino)hexyl-dATP - Biotin, pack	50	172-Eur	Jena Bio
NU-835L	Nucleic acids: N6-(6-Amino)hexyl-dATP, L pack	150Units	316-Eur	Jena Bio
NU-835S	Nucleic acids: N6-(6-Amino)hexyl-dATP, S pack	30Units	128-Eur	Jena Bio
NU-845-25	Nucleic acids: alpha-[(6-Aminohexyl)-imido]-dGMP, 25 mg pack	25mg	316-Eur	Jena Bio
bs-3679P	Peptides: COMP Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1618-TXR	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - Texas Red	240	1175-Eur	Jena Bio
NU-1618-532	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - ATTO-532	80	1175-Eur	Jena Bio
NU-1618-495	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - ATTO-495	80	1175-Eur	Jena Bio
NU-1618-488	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - ATTO-488	80	1175-Eur	Jena Bio
NU-1618-465	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - ATTO-465	160	1175-Eur	Jena Bio
NU-1618-425	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - ATTO-425	160	1175-Eur	Jena Bio
NU-1618-390	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - ATTO-390	160	1175-Eur	Jena Bio
NU-1618-1	Nucleic acids: 7-Deaza-7-propargylamino-ddGTP, 1 mg pack	1mg	1005-Eur	Jena Bio
NU-1615-TXR	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - Texas Red	120	1095-Eur	Jena Bio
NU-1615-TAM	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - 5_6-TAMRA	120	1095-Eur	Jena Bio
NU-1615-MNT	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - MANT	100	1095-Eur	Jena Bio
NU-1615-MB2	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - ATTO-MB2	400	1095-Eur	Jena Bio
NU-1615-740	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - ATTO-740	40	1095-Eur	Jena Bio
NU-1615-725	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - ATTO-725	40	1095-Eur	Jena Bio
NU-1615-700	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - ATTO-700	40	1095-Eur	Jena Bio
NU-1615-680	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - ATTO-680	40	1095-Eur	Jena Bio
NU-1615-665	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - ATTO-665	400	1095-Eur	Jena Bio
NU-1618-550	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - ATTO-550	80	1175-Eur	Jena Bio
NU-1618-565	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - ATTO-565	160	1175-Eur	Jena Bio
NU-1618-TAM	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - 5_6-TAMRA	240	1175-Eur	Jena Bio
NU-1618-MNT	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - MANT	200	1175-Eur	Jena Bio
NU-1618-MB2	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - ATTO-MB2	80	1175-Eur	Jena Bio
NU-1618-740	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - ATTO-740	80	1175-Eur	Jena Bio
NU-1618-725	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - ATTO-725	80	1175-Eur	Jena Bio
NU-1618-700	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - ATTO-700	80	1175-Eur	Jena Bio
NU-1618-680	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - ATTO-680	80	1175-Eur	Jena Bio
NU-1618-665	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - ATTO-665	400	1175-Eur	Jena Bio
NU-1618-661Q	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - DYQ-661	80	1175-Eur	Jena Bio
NU-1618-660Q	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - DYQ-660	80	1175-Eur	Jena Bio
NU-1618-656	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - OYSTER-656	80	1175-Eur	Jena Bio
NU-1618-655	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - ATTO-655	80	1175-Eur	Jena Bio
NU-1618-633	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - ATTO-633	80	1175-Eur	Jena Bio
NU-1618-620	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - ATTO-620	80	1175-Eur	Jena Bio
NU-1618-594	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - ATTO-594	80	1175-Eur	Jena Bio
NU-1618-590	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - ATTO-590	160	1175-Eur	Jena Bio
NU-1615-661Q	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - DYQ-661	40	1095-Eur	Jena Bio
NU-1615-660Q	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - DYQ-660	40	1095-Eur	Jena Bio
NU-1615-656	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - OYSTER-656	40	1095-Eur	Jena Bio
NU-1612-MB2	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - ATTO-MB2	80	746-Eur	Jena Bio
NU-234S	Nucleic acids: 2-Aminopurine-riboside-5'-triphosphate, S pack	20Units	128-Eur	Jena Bio
NU-235L	Nucleic acids: 2-Aminopurine-riboside-5'-monophosphate, L pack	100Units	316-Eur	Jena Bio
NU-235S	Nucleic acids: 2-Aminopurine-riboside-5'-monophosphate, S pack	20Units	128-Eur	Jena Bio
NU-303L	Nucleic acids: NPE-caged-Mant-dGTP, L pack	50Units	316-Eur	Jena Bio
NU-303S	Nucleic acids: NPE-caged-Mant-dGTP, S pack	10Units	128-Eur	Jena Bio
NU-1612-740	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - ATTO-740	80	746-Eur	Jena Bio
NU-1612-725	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - ATTO-725	80	746-Eur	Jena Bio
NU-1612-700	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - ATTO-700	80	746-Eur	Jena Bio
NU-1612-680	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - ATTO-680	80	746-Eur	Jena Bio
NU-1612-665	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - ATTO-665	400	746-Eur	Jena Bio
NU-1612-661Q	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - DYQ-661	80	746-Eur	Jena Bio
NU-1612-660Q	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - DYQ-660	80	746-Eur	Jena Bio
NU-1612-656	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - OYSTER-656	80	746-Eur	Jena Bio
NU-1612-655	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - ATTO-655	80	746-Eur	Jena Bio
NU-1612-633	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - ATTO-633	80	746-Eur	Jena Bio
NU-1612-MNT	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - MANT	240	746-Eur	Jena Bio
NU-1612-TAM	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - 5_6-TAMRA	240	746-Eur	Jena Bio
NU-1615-655	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - ATTO-655	40	1095-Eur	Jena Bio
NU-1615-633	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - ATTO-633	40	1095-Eur	Jena Bio
NU-1615-620	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - ATTO-620	40	1095-Eur	Jena Bio
NU-1615-594	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - ATTO-594	40	1095-Eur	Jena Bio
NU-1615-590	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - ATTO-590	80	1095-Eur	Jena Bio
NU-1615-565	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - ATTO-565	80	1095-Eur	Jena Bio
NU-1615-550	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - ATTO-550	40	1095-Eur	Jena Bio
NU-1615-532-XX	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - ATTO-532-XX	40	1095-Eur	Jena Bio
NU-1615-532	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - ATTO-532	40	1095-Eur	Jena Bio
NU-1615-495	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - ATTO-495	40	1095-Eur	Jena Bio
NU-1615-488	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - ATTO-488	80	1095-Eur	Jena Bio
NU-1615-465	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - ATTO-465	80	1095-Eur	Jena Bio
NU-1615-425	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - ATTO-425	80	1095-Eur	Jena Bio
NU-1615-390	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - ATTO-390	80	1095-Eur	Jena Bio
NU-1615-1	Nucleic acids: 7-Deaza-7-propargylamino-dGTP, pack	1,7	933-Eur	Jena Bio
NU-1612-TXR	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - Texas Red	120	746-Eur	Jena Bio
NU-1612-620	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - ATTO-620	80	746-Eur	Jena Bio
bs-1328P	Peptides: MT(metallothionein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1181P	Peptides: ORX-A(orexin-A) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1177P	Peptides: Lingo-1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1172P	Peptides: N-cadherin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1171P	Peptides: Annexin A Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1164P	Peptides: ADFP_ADRP_adipophilin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1160P	Peptides: Gelsolin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1148P	Peptides: Cyclin D2 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1132P	Peptides: Somatostatin_GRIH Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1117P	Peptides: Lgr5_GPR49 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1111P	Peptides: Oct-4(Octamer-4) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1109P	Peptides: IQGAP1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1106P	Peptides: CK8(Cytokeratin 8) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1105P	Peptides: Caspase-12 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1100P	Peptides: CD36 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1099P	Peptides: Calpain 1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1061P	Peptides: MPO peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1183P	Peptides: IL-17(Interleukin-17) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1193P	Peptides: IL-23(Interleukin-23) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1318P	Peptides: IL-5 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1315P	Peptides: Nogo-B_A Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1313P	Peptides: VEGF Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1309P	Peptides: CD138_Syndecan-1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1306P	Peptides: CAP1_Park7_DJ-1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1299P	Peptides: Parvalbumin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1297P	Peptides: CD28 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1276P	Peptides: Erdj5_DNAJC10 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1273P	Peptides: E-Selectin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1269P	Peptides: DCX(Doublecortin) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1248P	Peptides: S100B Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1240P	Peptides: Hu Fibrinogen Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1223P	Peptides: Aggrecan Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1221P	Peptides: Rad51 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1212P	Peptides: TRAF1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1211P	Peptides: TP I (topoisomerase I ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1060P	Peptides: CK5(Cytokeratin 5) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1058P	Peptides: LIF peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1056P	Peptides: 5-HTR2A Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0911P	Peptides: Batroxobin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0902PB	Peptides: IAA_BSA Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0879P	Peptides: Flag-Tag (CT) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0861PB	Peptides: 2,4-D_BSA Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0834P	Peptides: GAPDH Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0821P	Peptides: LN (laminin) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0819P	Peptides: Tyrosinase Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0817P	Peptides: MAGE-1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0809P	Peptides: Fibulin 1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0806P	Peptides: Collagen IV Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0802P	Peptides: BRCA1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0795P	Peptides: Resistin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0778P	Peptides: Thy-1_CD90 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0767P	Peptides: IL-12(Interleukin-12) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0756P	Peptides: Vimentin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0748P	Peptides: PTEN_MMAC1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1175-BIOX	Nucleic acids: Biotin-11-dATP, pack	10	331-Eur	Jena Bio
bs-0972PA	Peptides: Gentamicin_OVA Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1055P	Peptides: Neurocan Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1039P	Peptides: Tenascin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1037P	Peptides: DCP peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1035P	Peptides: CD86_B7-2 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1034P	Peptides: SP-B peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1028P	Peptides: CK19 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1026P	Peptides: Des(Desmin) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1018P	Peptides: Muc-1_CD227 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1001P	Peptides: E2F2 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0991P	Peptides: HPV18 E6 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0976P	Peptides: LPLUNC1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0974PB	Peptides: Oxytetracycline_BSA Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0974PA	Peptides: Oxytetracycline_OVA Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0973PB	Peptides: Tetracycline_BSA Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0973PA	Peptides: Tetracycline_OVA Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0972PB	Peptides: Gentamicin_BSA Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0744P	Peptides: CEAcam8_CD67 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-3550P	Peptides: MYOG Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2175P	Peptides: NR1_NMDAR1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2174P	Peptides: Calcitonin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2129PK	Peptides: Morphine_KLH Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2129PB	Peptides: Morphine_BSA Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2115P	Peptides: Glu-Glu Tag peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2114P	Peptides: AU1 tag peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2089P	Peptides: sVEGFR2 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2081P	Peptides: TNF-alpha Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-142S	Nucleic acids: 6-Chlorpurine-riboside-5'-monophosphate, S pack	100Units	128-Eur	Jena Bio
NU-142L	Nucleic acids: 6-Chlorpurine-riboside-5'-monophosphate, L pack	500Units	316-Eur	Jena Bio
bs-2080P	Peptides: Cecropin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2072P	Peptides: NOS-2 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2059PK	Peptides: Metronidazole_KLH Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2059PB	Peptides: Metronidazole_BSA Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2059PA	Peptides: Metronidazole_OVA Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2046P	Peptides: Bursin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2182PA	Peptides: Melamine_OVA Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2190P	Peptides: CK19 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2570P	Peptides: CD26 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2558P	Peptides: EGFRvIII Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2540P	Peptides: GLUT12 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2535P	Peptides: TFPI_LACI Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2450P	Peptides: CCL1_TCA3_I-309 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2445P	Peptides: Aurora B Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2426P	Peptides: glypican 1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2425P	Peptides: Apelin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2411P	Peptides: NKG2A_CD159a_KLRC1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2394P	Peptides: CKLF1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2337P	Peptides: SP-C peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2265P	Peptides: Peptide YY Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2252PK	Peptides: GABA_KLH Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2252PB	Peptides: GABA_BSA Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2231P	Peptides: AEG-1 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2211P	Peptides: CD80_B7-1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2044P	Peptides: LOX-1_OLR1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2038P	Peptides: CD34 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2037PK	Peptides: streptomycin_OVA Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1502P	Peptides: CXCL10_IP-10 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1478P	Peptides: PAFR_PTAFR Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1459P	Peptides: gp130_IL-6R Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1449P	Peptides: PHB(Prohibitin) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1448P	Peptides: CD339_Jagged1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1432P	Peptides: CD68 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1427P	Peptides: IRAK 2 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1425P	Peptides: ASK1_MAPKKK5 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1417P	Peptides: NFATc1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1399P	Peptides: E2F4 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1398P	Peptides: ELK1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1384P	Peptides: APG4B_AUTL1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1375P	Peptides: Ghrelin 28 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1371P	Peptides: Snail Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1343P	Peptides: Ezrin_Radixin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
3422-001-01	CultrexHuman Vitronectin, Nucleic Acids Reduced, PathClear	50	196-Eur	Trevigen
bs-1519P	Peptides: E-cadherin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1523P	Peptides: CD63_MLA1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2037PB	Peptides: streptomycin_BSA Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2037PA	Peptides: streptomycin_OVA Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1914P	Peptides: thrombin_Prothrombin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1849P	Peptides: MK(Midkine) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1839P	Peptides: lamin A Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1830P	Peptides: IL-16(Interleukin-16) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1829P	Peptides: IL-15(Interleukin-15) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1811P	Peptides: IL-7(Interleukin-7) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1756P	Peptides: Elastin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1750P	Peptides: E2F6 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1739P	Peptides: Wnt1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1703P	Peptides: cRaf_Raf1(c-raf 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1664P	Peptides: Proinsulin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1618P	Peptides: CD146_MCAM Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1559P	Peptides: GLP-1R peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1549P	Peptides: Ubiquitin Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1329P	Peptides: ZO-1 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
10-783-79039	RECOMBINANT HUMAN INTERLEUKIN-8 (72 AMINO ACIDS) - CXCL8	0.025 mg	502-Eur	GenWay	recombinant
LIP	Lipolysis Treatment Screening KIT (glycerol and free fatty acids)	kit	1276-Eur	ZenBio	assays
N-20311-250	Nucleic acids: 3'-Amino-2'_3'-dideoxy-adenosine, 250 mg pack	250mg	106-Eur	Jena Bio
N-20311-1G	Nucleic acids: 3'-Amino-2'_3'-dideoxy-adenosine, 1 g pack	1g	201-Eur	Jena Bio
N-20311-10G	Nucleic acids: 3'-Amino-2'_3'-dideoxy-adenosine, 10 g pack	10g	1167-Eur	Jena Bio
N-20310-250	Nucleic acids: 3'-Amino-2'_3'-dideoxy-guanosine, 250 mg pack	250mg	125-Eur	Jena Bio
N-20310-1G	Nucleic acids: 3'-Amino-2'_3'-dideoxy-guanosine, 1 g pack	1g	257-Eur	Jena Bio
N-20310-10G	Nucleic acids: 3'-Amino-2'_3'-dideoxy-guanosine, 10 g pack	10g	1546-Eur	Jena Bio
XC-E1154/500	MEM non Essential Amino Acids 100X w_o L_Glutamine _ 500ml		64-Eur	Biosera
XC-E1154/100	MEM non Essential Amino Acids 100X w_o L_Glutamine _ 100ml		37-Eur	Biosera
HSP05022	Hsp104(amino acids 1_908) Saccharomyces cerevisiae	200 ug	345-Eur	Assaypro
HSP05025	Hsp104(amino acids 1_908) Saccharomyces cerevisiae	1 mg	1403-Eur	Assaypro
N-20314-10G	Nucleic acids: 2'-Fluoro-2'-deoxy-inosine, 10 g pack	10g	2494-Eur	Jena Bio
N-20314-1G	Nucleic acids: 2'-Fluoro-2'-deoxy-inosine, 1 g pack	1g	400-Eur	Jena Bio
LIP	Lipolysis Assay KIT, Free fatty acids Detection (REAGENTS ONLY)	kit	626-Eur	ZenBio	elisa
K-CF0007	Main filter for Circulaire 800 ACID _ Mineral Acids	1PCE	359-Eur	Monmouth Scientific
K-CF0121	Main filter for Circulaire 900 ACID _ Mineral Acids	1PCE	393-Eur	Monmouth Scientific
K-CF0081	Main filter for Circulaire 650 ACID _ Mineral Acids	1PCE	326-Eur	Monmouth Scientific
10-783-79038	RECOMBINANT HUMAN INTERLEUKIN-8 (77 AMINO ACIDS) - CXCL8	0.025 mg	502-Eur	GenWay	recombinant
K-CF0133	Main filter for Circulaire 550 ACID _ Mineral Acids	1PCE	326-Eur	Monmouth Scientific
ABS12389	RECOMBINANT HUMAN DEFENSIN BETA 1 (36 AMINO ACIDS)	20 µg	242-Eur	AbD
N-20317-50G	Nucleic acids: 2’-Fluoro-2’-deoxy-adenosine, 50 g pack	50g	5148-Eur	Jena Bio
N-20317-1G	Nucleic acids: 2’-Fluoro-2’-deoxy-adenosine, 1 g pack	1g	153-Eur	Jena Bio
N-20317-10G	Nucleic acids: 2’-Fluoro-2’-deoxy-adenosine, 10 g pack	10g	1167-Eur	Jena Bio
N-20315-50G	Nucleic acids: 2'-Fluoro-2'-deoxy-guanosine, 50 g pack	50g	5906-Eur	Jena Bio
N-20315-1G	Nucleic acids: 2'-Fluoro-2'-deoxy-guanosine, 1 g pack	1g	163-Eur	Jena Bio
N-20315-10G	Nucleic acids: 2'-Fluoro-2'-deoxy-guanosine, 10 g pack	10g	1319-Eur	Jena Bio
CLK-AA002-10	Amino acids or its derivatives: 4-Azido-D-phenylalanine, 10 mg pack	10mg	146-Eur	Jena Bio
N-20314-250	Nucleic acids: 2'-Fluoro-2'-deoxy-inosine, 250 mg pack	250mg	191-Eur	Jena Bio
T 437-10	MEM powder medium with Earle's salts with not-essential amino acids	10 l	46-Eur	Biochro	cell culture
DNJ30012	DnaJ(Amino acids 1_376), Recombinant, E.coli	200 ug	300-Eur	Assaypro	recombinant
DNJ30015	DnaJ(Amino acids 1_376), Recombinant, E.coli	1 mg	1133-Eur	Assaypro	recombinant
CLK-AA001-10	Amino acids or its derivatives: 4-Azido-L-phenylalanine, 10 mg pack	10mg	146-Eur	Jena Bio
CLK-AA001-100	Amino acids or its derivatives: 4-Azido-L-phenylalanine, 100 mg pack	100mg	392-Eur	Jena Bio
CLK-AA001-5	Amino acids or its derivatives: 4-Azido-L-phenylalanine, 5 mg pack	5mg	106-Eur	Jena Bio
CLK-AA001-500	Amino acids or its derivatives: 4-Azido-L-phenylalanine, 500 mg pack	500mg	899-Eur	Jena Bio
CLK-AA002-100	Amino acids or its derivatives: 4-Azido-D-phenylalanine, 100 mg pack	100mg	392-Eur	Jena Bio
CLK-AA002-5	Amino acids or its derivatives: 4-Azido-D-phenylalanine, 5 mg pack	5mg	106-Eur	Jena Bio
CLK-AA002-500	Amino acids or its derivatives: 4-Azido-D-phenylalanine, 500 mg pack	500mg	899-Eur	Jena Bio
DNJ3001	DnaJ(Amino acids 1_376), Recombinant, E.coli	100ug	202-Eur	ATGen	recombinant
CPP-A07S	Amino acids or its derivatives: Glycine buffer pH 3.0, S pack	25ml	44-Eur	Jena Bio
CPP-A07L	Amino acids or its derivatives: Glycine buffer pH 3.0, L pack	125ml	85-Eur	Jena Bio
C010-500GM	Amino Acids,L-Cysteine, Hydrochloride, Monohydrate	500G	175-Eur	Caisson Laboratory
C010-100GM	Amino Acids,L-Cysteine, Hydrochloride, Monohydrate	100G	80-Eur	Caisson Laboratory
T 437-05	MEM powder medium with Earle's salts with not_essential amino acids	5 l	61-Eur	Biochro	cell culture
06344-14	MEM Non_ Essential Amino Acids Solution(100x)	20 ml	23-Eur	Nacala
06344-56	MEM Non_ Essential Amino Acids Solution(100x)	100 ml	42-Eur	Nacala
21443-15	MEM with Earle's Salts, L‐Gln and Non‐Essential Amino Acids, liquid CAS:	500ML	113-Eur	Nacala
01-2232	Antigens HSP 90 (amino acids 1-732), Human, Recombinant, His-tag, E.coli	20	303-Eur	ARP
YSRTPHP054	Interleukin 8 (IL_8), 9kD, 77 amino acids, Human, recombinant	25 µg.	438-Eur	Accu	recombinant
N-1060	Nucleic acids: N2-(2-Amino)ethyl-guanosine, 5 mg pack	5mg	132-Eur	Jena Bio
N-1053	Nucleic acids: 6-Methyl-thio-inosine, 1 g pack	1g	342-Eur	Jena Bio
DNJ3001	DnaJ(Amino acids 1_376), Recombinant, E.coli	1mg	502-Eur	ATGen	recombinant
E7258h	Human Elongation Of Very Long Chain Fatty Acids Li	96T	706-Eur	EIAab	human
E13832h	Human Elongation Of Very Long Chain Fatty Acids Li	96T	706-Eur	EIAab	human
E13833h	Human Elongation Of Very Long Chain Fatty Acids Li	96T	706-Eur	EIAab	human
T 437-50	MEM powder medium with Earle's salts with not_essential amino acids	50 l	112-Eur	Biochro	cell culture
E13834h	Human Elongation Of Very Long Chain Fatty Acids Li	96T	706-Eur	EIAab	human
T 437-10	MEM powder medium with Earle's salts with not_essential amino acids	10 l	68-Eur	Biochro	cell culture
HSP0501	HSP90 (amino acids 1-732), Human, Recombinant, His-tag, E.coli	0.5mg	920-Eur	ATGen	recombinant
E2705h	Human Elongation Of Very Long Chain Fatty Acids Li	96T	706-Eur	EIAab	human
E5070h	Human Elongation Of Very Long Chain Fatty Acids Li	96T	706-Eur	EIAab	human
YSRTPHP210	Defensin Beta 1 (36 Amino Acids), Human Recombinant	20 µg.	438-Eur	Accu	recombinant
YSRTPHP055	Interleukin 8 (IL_8), 8.5kD, 72 amino acids, Human, recombinant	25 µg.	438-Eur	Accu	recombinant
21443-15	MEM with Earle's Salts, L‐Gln and Non‐Essential Amino Acids, liquid	500ML	118-Eur	Nacala
N-DN-2013-100	Nucleic acids: 5-Methyl-2'-deoxy-cytidine, 100 mg pack	100mg	96-Eur	Jena Bio
N-DN-4567-500	Nucleic acids: 7-Deaza-2'-deoxy-guanosine, 500 mg pack	500mg	314-Eur	Jena Bio
HSP05021	Hsp104(amino acids 1_908) Saccharomyces cerevisiae	50 µg	165-Eur	Assaypro
N-1042	Nucleic acids: 6-Methyl-thio-guanosine, 100 mg pack	100mg	342-Eur	Jena Bio
N-DN-2013-1G	Nucleic acids: 5-Methyl-2'-deoxy-cytidine, 1 g pack	1g	477-Eur	Jena Bio
NK-116-100	Nucleic acids: Adenosine Kit HPLC Retention Time Standard	100	198-Eur	Jena Bio
NK-117-100	Nucleic acids: Guanosine Kit HPLC Retention Time Standard	100	198-Eur	Jena Bio
N-20335-250	Nucleic acids: 2-Fluoro-2'-deoxy-adenosine, 250 mg pack	250mg	191-Eur	Jena Bio
N-20335-1G	Nucleic acids: 2-Fluoro-2'-deoxy-adenosine, 1 g pack	1g	400-Eur	Jena Bio
N-20335-10G	Nucleic acids: 2-Fluoro-2'-deoxy-adenosine, 10 g pack	10g	2494-Eur	Jena Bio
N-20332-250	Nucleic acids: Arabinofuranosyl-2-fluoro-adenine, 250 mg pack	250mg	220-Eur	Jena Bio
N-20332-1G	Nucleic acids: Arabinofuranosyl-2-fluoro-adenine, 1 g pack	1g	456-Eur	Jena Bio
N-20332-10G	Nucleic acids: Arabinofuranosyl-2-fluoro-adenine, 10 g pack	10g	2873-Eur	Jena Bio
N-20340-10G	Nucleic acids: 2'-Fluoro-2'-deoxy-isoguanosine, 10 g pack	10g	8559-Eur	Jena Bio
N-20340-1G	Nucleic acids: 2'-Fluoro-2'-deoxy-isoguanosine, 1 g pack	1g	1309-Eur	Jena Bio
N-DN-1143-500	Nucleic acids: 7-Deaza-2'-deoxy-adenosine, 500 mg pack	500mg	314-Eur	Jena Bio
N-DN-1143-1G	Nucleic acids: 7-Deaza-2'-deoxy-adenosine, 1 g pack	1g	534-Eur	Jena Bio
N-DN-1143-100	Nucleic acids: 7-Deaza-2'-deoxy-adenosine, 100 mg pack	100mg	87-Eur	Jena Bio
DNJ30015	DnaJ(Amino acids 1_376), Recombinant, E.coli	1 mg	1123-Eur	Assaypro	recombinant
DNJ30012	DnaJ(Amino acids 1_376), Recombinant, E.coli	0.2 mg	313-Eur	Assaypro	recombinant
N-20341-250	Nucleic acids: 2'-Amino-2'-deoxy-inosine, 250 mg pack	250mg	276-Eur	Jena Bio
N-DN-2013-500	Nucleic acids: 5-Methyl-2'-deoxy-cytidine, 500 mg pack	500mg	257-Eur	Jena Bio
N-20341-1G	Nucleic acids: 2'-Amino-2'-deoxy-inosine, 1 g pack	1g	599-Eur	Jena Bio
N-20341-10G	Nucleic acids: 2'-Amino-2'-deoxy-inosine, 10 g pack	10g	3821-Eur	Jena Bio
N-DN-4567-100	Nucleic acids: 7-Deaza-2'-deoxy-guanosine, 100 mg pack	100mg	87-Eur	Jena Bio
N-DN-4567-1G	Nucleic acids: 7-Deaza-2'-deoxy-guanosine, 1 g pack	1g	534-Eur	Jena Bio
N-20340-250	Nucleic acids: 2'-Fluoro-2'-deoxy-isoguanosine, 250 mg pack	250mg	580-Eur	Jena Bio
T-003-22	Nesfatin_1 (Rat) (82 amino acids) _ Iodine 125 Labeled Tracer _ 10uCi	10 µCi	1038-Eur	Phoenix Peptide	labeled
HSP05022	Hsp104(amino acids 1_908) Saccharomyces cerevisiae	0.2 mg	429-Eur	Assaypro
N-20329-1G	Nucleic acids: 2'-Amino-2'-deoxy-guanosine, 1 g pack	1g	741-Eur	Jena Bio
N-20327-250	Nucleic acids: 2'-Amino-2'-deoxy-adenosine, 250 mg pack	250mg	314-Eur	Jena Bio
N-20327-1G	Nucleic acids: 2'-Amino-2'-deoxy-adenosine, 1 g pack	1g	684-Eur	Jena Bio
NU-021-2	Nucleic acids: Ribavirin-5'-monophosphate, 2 mg pack Sodium salt	2mg	725-Eur	Jena Bio
N-20329-10G	Nucleic acids: 2'-Amino-2'-deoxy-guanosine, 10 g pack	10g	4768-Eur	Jena Bio
N-20329-250	Nucleic acids: 2'-Amino-2'-deoxy-guanosine, 250 mg pack	250mg	333-Eur	Jena Bio
DNJ30011	DnaJ(Amino acids 1_376), Recombinant, E.coli	50 ug	135-Eur	Assaypro	recombinant
N-20327-10G	Nucleic acids: 2'-Amino-2'-deoxy-adenosine, 10 g pack	10g	4389-Eur	Jena Bio
FG-003-26B	Nesfatin_1 (Human) (82 amino acids) _ FITC Labeled _ 1 nmol	1 nmol	622-Eur	Phoenix Peptide	labeled
B-003-26	Nesfatin_1 (Human) (82 amino acids) _ Biotin Labeled _ 10ug	10 µg	622-Eur	Phoenix Peptide	labeled
HSP05025	Hsp104(amino acids 1_908) Saccharomyces cerevisiae	1 mg	1432-Eur	Assaypro
K-CF0067	Outlet filter for Circulaire 800 ACID _ Mineral Acids	1PCE	192-Eur	Monmouth Scientific
bs-0009P	Peptides: Alpha-Synuclein Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0397P	Peptides: MMP-9(matrix metalloproteinase 9) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-OXEL019-2	Nucleic acids: Aciclovir-5'-monophosphate, 2 mg pack Triethylammonium salt	2mg	725-Eur	Jena Bio
bs-0569P	Peptides: CDK7_Cyclin H_MAT1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1062P	Peptides: ADRA2 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-OXEL008-2	Nucleic acids: Clofarabine-5'-triphosphate, 3.7 mg pack Triethylammonium salt	3,7mg	725-Eur	Jena Bio
bs-2357P	Proteins: PACAP(6-38 Peptide) Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
NU-1607L	Nucleic acids: Gemcitabine-Triphosphate, L pack Sodium Salt	250Units	331-Eur	Jena Bio
NU-1608S	Nucleic acids: Gemcitabine-Diphosphate, S pack Sodium Salt	20Units	133-Eur	Jena Bio
NU-1608L	Nucleic acids: Gemcitabine-Diphosphate, L pack Sodium Salt	100Units	331-Eur	Jena Bio
21443-15	MEM with Earle's Salts, L_ Gln and Non_ Essential Amino Acids, liquid	500 ml	27-Eur	Nacala
NU-1607S	Nucleic acids: Gemcitabine-Triphosphate, S pack Sodium Salt	50Units	133-Eur	Jena Bio
bs-1551P	Peptides: Pepsinogen C peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
GYNBw/oAA100	Yeast Nitrogen Base w_o Amino Acids, powder	500 g	344-Eur	ProtEra	yeast
MIF0501	MIF (amino acids 1_115) Human,Recombinant, His_tag, E.coli	100ug	226-Eur	ATGen	recombinant
NU-1705L	Nucleic acids: Azide-PEG4-aminoallyl-dUTP, L pack	250Units	316-Eur	Jena Bio
bs-4622P	Proteins: Mycobacterium bovis Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-1159P	Peptides: P-cadherin(placental) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1071P	Peptides: H-ras_Ras_Ras p21 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0681P	Peptides: Insulin Receptor(ISR) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0401P	Peptides: Metal ion transporter Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1761P	Peptides: ABCD-1_CCL22 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1074P	Peptides: Nrf2 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1748P	Peptides: DP-I_DSP(desmoplakin I ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-OXEL020-2	Nucleic acids: Aciclovir-5'-triphosphate, 2 mg pack Triethylammonium salt	2mg	725-Eur	Jena Bio
bs-1762P	Peptides: CCL26(Eotaxin 3) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
BQ092A-EALD	LIVER DISEASES Total Bile Acids (TBA) (Colorimetric) Kit	600 Tests / Kit	501-Eur	Bioquant	assays
bs-1566P	Peptides: Cripto-1(N-Terminus) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1163P	Peptides: Defensin Beta1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1705S	Nucleic acids: Azide-PEG4-aminoallyl-dUTP, S pack	50Units	128-Eur	Jena Bio
bs-0400P	Peptides: GAD-65 (glutamate decarboxylase) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1671P	Peptides: CCR-2A(C-C Chemokine receptor 2A) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-927-BIO	Nucleic acids: gamma-[Ethyl-CONH-(PEG4)]-ATP - Biotin, pack	50	172-Eur	Jena Bio
bs-0707P	Peptides: NF-L(Neurofilament triplet L) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
3422-001-01	Cultrex Human Vitronectin, Nucleic Acids Reduced, PathClear	50	196-Eur	Trevigen
bs-1639P	Peptides: phospho-FAK(pTyr577) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-OXEL003-2	Nucleic acids: Gemcitabine-5'-monophosphate, 2 mg pack Sodium salt	2mg	725-Eur	Jena Bio
SMC-131D	HO-1 Monoclonals Antibodies1F12-A6 Human HO-1 synthetic peptide, amino acids 1-30	100ug	328-Eur	Stressmarq
SMC-131C	HO-1 Monoclonals Antibodies1F12-A6 Human HO-1 synthetic peptide, amino acids 1-30	25ug	187-Eur	Stressmarq
bs-0701P	Peptides: GCS (glucosylceramide synthase, GCS) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1122P	Peptides: Sema3F (semaphorin 3F) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1126P	Peptides: 5-HT(5-Hydroxy-L-tryptophan_L-5-HTP) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1130P	Peptides: SIP1 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0468P	Peptides: CD31(PECAM-1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0726P	Peptides: BIRC5_Survivin variant Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0716P	Peptides: CIDEB peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0710P	Peptides: NF-M (Neurofilament triplet M) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0709P	Peptides: Anti-Collagen II Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0708P	Peptides: NF-H(Neurofilament triplet H) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-4532PB	Proteins: Clenbuterol Hydrochloride_BSA Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-4532PK	Proteins: Clenbuterol Hydrochloride_KLH Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-0414P	Peptides: MMP-14(Matrix metalloproteinase-14) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1149P	Peptides: ED-1 (Ectodermal Dysplasia 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
HSP05015	HSP 90 (amino acids 1_732), Human, Recombinant, His_tag, E.coli	1 mg	1403-Eur	Assaypro	recombinant
NU-OXEL007-2	Nucleic acids: Clofarabine-5'-monophosphate, 3 mg pack Triethylammonium salt	3mg	725-Eur	Jena Bio
MIF0501	MIF (amino acids 1_115) Human,Recombinant, His_tag, E.coli	1mg	938-Eur	ATGen	recombinant
bs-1707P	Peptides: Ang I_AT1(Angiotensin I) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1096P	Peptides: Skp2 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1095P	Peptides: OXR (Orexin receptor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1088P	Peptides: T Beta10 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1083P	Peptides: VEGFR-3_FLt-4 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0733P-HRP	Peptides: ADAMTS7 peptide_HRP Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1610P	Peptides: CK7(Cytokeratin 7)human Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0733P	Peptides: ADAMTS7 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1154P	Peptides: FRA1_FOSL1 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1631P	Peptides: Annexin Ⅲ peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0575P	Peptides: MMP-13 (Matrix metalloproteinase 13) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
HSP05012	HSP 90 (amino acids 1_732), Human, Recombinant, His_tag, E.coli	100 ug	361-Eur	Assaypro	recombinant
HSP05011	HSP 90 (amino acids 1_732), Human, Recombinant, His_tag, E.coli	25 ug	156-Eur	Assaypro	recombinant
bs-1121P	Peptides: Sema3A (semaphorin 3A) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0410P	Peptides: Leptin receptor Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1157P	Peptides: FBN1 (fibrillin 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1156P	Peptides: IKB Beta (Inhibitor of KB) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2076PB	Proteins: METH_BSA (Methamphetamine_BSA) Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-2687P	Peptides: FOXM1_HFH 11 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0438P	Peptides: Angiotensin II receptor(Ang II ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0841P	Peptides: GLP-2(Glucagon-like peptide-2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
HSP0603	HSP70 (amino acids 1-641) Human, Recombinant, His- tagged, E.coli	100ug	226-Eur	ATGen
bs-0453P	Peptides: NKR(Neuromedin B Receptor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0952P	Peptides: LH(Luteinizing Hormone) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0951P	Peptides: LH(Luteinizing Hormone) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2436P	Peptides: Kir6.2 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
K-CF0018	Main filter for Circulaire 1100 ACID _ Mineral Acids	1PCE	326-Eur	Monmouth Scientific
K-CF0007	Main filter for Circulaire 1400 ACID _ Mineral Acids	1PCE	359-Eur	Monmouth Scientific
bs-2093P	Peptides: Integrin Alpha3 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
K-CF0055	Outlet filter for Circulaire 1100 ACID _ Mineral Acids	1PCE	180-Eur	Monmouth Scientific
HSP0603	HSP70 (amino acids 1-641) Human, Recombinant, His- tagged, E.coli	0.5mg	478-Eur	ATGen
bs-2560P	Peptides: H2AX peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2604P	Peptides: IL-12R Beta2_IL12RB2 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2651P	Peptides: ELAVL1_HuR peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0967P	Peptides: Caspase-12(hunman) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0965P	Peptides: DYKDDDDK Tag(CT)_Flag-Tag Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0829P	Peptides: Nanog fragment Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0831P	Peptides: Nadrin peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2043P	Peptides: CK18 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
BQ 092A-EALD	LIVER DISEASES-Total Bile Acids (TBA) (Colorimetric) Kit	600	510-Eur	Smart Serology	assays
bs-2047P	Peptides: CPT1A peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
GYNBw/oAA100	Yeast Nitrogen Base w_o Amino Acids, powder	100 g	69-Eur	ProtEra	yeast
bs-0961P	Peptides: Leptin receptor(a、b、c、d) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2639P	Peptides: PGE2 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2373P	Peptides: Ceruloplasmin peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2094P	Peptides: Integrin Beta5 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
K-CF0067	Outlet filter for Circulaire 1400 ACID _ Mineral Acids	1PCE	192-Eur	Monmouth Scientific
bs-2221P	Peptides: ATEXPA10 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2141P	Peptides: Cripto-1(C-Terminus) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
HSP05012	HSP 90 (amino acids 1_732), Human, Recombinant, His_tag, E.coli	0.2 mg	475-Eur	Assaypro	recombinant
bs-2162P	Peptides: DKK1(Dickkopf 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
HSP05015	HSP 90 (amino acids 1_732), Human, Recombinant, His_tag, E.coli	1 mg	1540-Eur	Assaypro	recombinant
bs-2209P	Peptides: CXCR3_CD183 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2203P	Peptides: Integrin alpha V Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0904PA	Peptides: Melamine_OVA(ovalbumin) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0903P	Peptides: Natrexone_BSA:Natrexone_KLH Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2173P	Peptides: OLFM1 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2183P	Peptides: Claudin-11 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
T-003-26	Nesfatin_1 (Human) (82 amino acids) _ Iodine 125 Labeled Tracer _ 10uCi	10 µCi	974-Eur	Phoenix Peptide	labeled
bs-0921P	Peptides: SIRT1(sirtuin 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2140P	Peptides: IL-17(Interleukin-17)human Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2095P	Peptides: Integrin alpha 1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
K-CF0081	Main filter for Circulaire FB250 ACID _ Mineral Acids	1PCE	326-Eur	Monmouth Scientific
K-CF0031	Main filter for Circulaire W700 ACID _ Mineral Acids	1PCE	326-Eur	Monmouth Scientific
bs-2099P	Peptides: MMP-9(matrix metalloproteinase 9) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0557P	Peptides: Mfn1 (Mitofusin1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2106P	Peptides: PENK_Enkephalin A(Preproencephalin A) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
LIP	Lipolysis Assay KIT, Free fatty acids Detection (REAGENTS +CELLS)	kit	1114-Eur	ZenBio	elisa
bs-0871P	Peptides: Beta-Amyloid (31-35) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2249P	Peptides: ACA11 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2247P	Peptides: AHA3 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0447P	Peptides: TPO(Thyroid Peroxidase) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0893P	Peptides: phospho-BAD(pSer128) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0764P	Peptides: CCK8 (Cholecystokinin-8) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
Y-0211	Peptides: Pentapeptide-3_Leuphasyl Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
Y-0210	Peptides: MT-II(Melanotan II Acetate) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
Y-0209	Peptides: Matrixyl Acetate Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1825P	Peptides: Inhibin beta B Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
Y-0206	Peptides: Argireline peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1862P	Peptides: MMP-17(Matrix metalloproteinase-17) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1879P	Peptides: PSAP_PAP peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0994P	Proteins: rSLT_SLT-IIe(O139) Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-1929P	Peptides: UCN(Urocortin)mouse ret Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
Y-0158	Peptides: Amylin(1-37) amide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
Y-0133	Peptides: ADM 1-52_AM 1-52 (Adrenomedullin 1-52) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
Y-0212	Peptides: PT141(Bremelanotide PT-141) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0781P	Peptides: IL-6 (Interleukin-6) Human Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
Yf-0158P	Peptides: Amylin1-37_FITC Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0765P	Peptides: CD3 epsilon peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1059P	Peptides: CK18(Cytokeratin 18) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1771P	Peptides: IL-14_Taxilin alpha Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1054P	Peptides: L-HDC (L-Histidine decarboxylase) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1775P	Peptides: FOXJ1_HFH-4 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1050P	Peptides: Cx40 (Connexin-40) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0514P	Proteins: rhBMP-2_BMP2 Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-0775P	Peptides: CG6856-PA peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1792P	Peptides: CK14_17_42_10 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1808P	Peptides: Hpt_HP(haptoglobin) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1810P	Peptides: LDH(Lactate Dehydrogenase) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1930P	Peptides: ADH_AVP peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1954P	Peptides: BSEP peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1032P	Peptides: Inhibin Alpha Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0986P	Peptides: BCHE(butyrylcholinesterase)NT Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0985P	Peptides: MMP-20(matrix metalloproteinase 20) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0980P	Peptides: CD38(human) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
BF037	*Vitamino Growth Supplement (Vitamins & Amino Acids Mixture)	Qty per Litre of Medium:	1-Eur	biomarkt
BF037	*Vitamino Growth Supplement (Vitamins & Amino Acids Mixture)	Qty per Litre of Medium:	1-Eur	biomarkt
bs-3681P	Peptides: ADCY1 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0979P	Peptides: CD38(mouse, rat) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2036PA	Peptides: Penicillin G_OVA Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0562P	Peptides: CCR-2_5(CC chemokine receptor 2_5) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2804P	Peptides: Cardiac Troponin T Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2036PB	Peptides: Penicillin G_BSA Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0987P	Peptides: BCHE(butyrylcholinesterase)CT Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1479P	Peptides: CD80_B7-1(human) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1005P	Peptides: CK2(casein kinase 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
Y-0108	Peptides: GRGDS peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0423P	Peptides: MMP-7(Matrilysin_matrix metalloproteinases-7) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
69627	VIP, human, porcine, rat; VIP (28 amino acids) Formula C147H238N44O42S1 Sequence His_Ser_Asp_Ala_Val_Phe_Thr_Asp_Asn_Tyr_Thr_Arg_Leu_Arg_Lys_Gln_Met_Ala_Val_Lys_Lys_Tyr_Leu_Asn_Ser_Ile_Leu_Asn_NH2	1mg	172-Eur	GLSChina	human
bssl-C8280	Peptides: Cholesterol Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-6282P	Peptides: SCCA peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-4948P	Proteins: Bacillus anthraci Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
HSP0502	Hsp104(amino acids 1-908) Saccharomyces cerevisiae, Recombinant, E.coli	0.5mg	478-Eur	ATGen	recombinant
HSP0603	HSP70 (amino acids 1-641) Human, Recombinant, His- tagged, E.coli	0.5mg	531-Eur	ATGen	recombinant
bs-1014P	Peptides: Mac-1 (Mac-1_CR3_CD11b+CD18) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-5907P	Peptides: Ferritin peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1993P	Peptides: Muc2 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0823P	Peptides: PGRN (progranulin) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0119P	Peptides: FLIP S_L peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1285P	Peptides: ets1_E26 (E-twenty six 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0205P	Peptides: GHRF (GHRH) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1421P	Peptides: CBX3_HP1 gamma Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1235P	Peptides: Haase(hyaluronidase) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1424P	Peptides: EPOR peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0208P	Peptides: GLP-2(Glucagon-like peptide-2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0210P	Peptides: Tubulin- Beta Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0598P	Peptides: DVL1 (dishevelled 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0601P	Peptides: PACAP(1-38 Peptide) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0605P	Peptides: IL-2 (Interleukin-2)Human Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1426P	Peptides: p70 S6 Kinase_P70 Beta1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1289P	Peptides: ChRM3 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1458P	Peptides: LIFR_CD118 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1294P	Peptides: ODC(Ornithine decarboxylase) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1316P	Peptides: PDGF-BB peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1314P	Peptides: OTR(oxytocin receptor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0117P	Peptides: TGF- Beta R2 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0195P	Peptides: CD31 (PECAM-1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0197P	Peptides: PACAP_VIP receptor Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0111P	Peptides: PR (Progestogerone receptor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0198P	Peptides: PACAP receptor-I Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1305P	Peptides: CCR-7(CC chemokine receptor 7) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1302P	Peptides: GAD-67 (glutamate decarboxylase 67) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
N-1051	Nucleic acids: Z (AICAR), 25 mg pack Z-riboside, Arasine, Acadesine	25mg	186-Eur	Jena Bio
bs-1419P	Peptides: MC-1R (melanocortin-1-receptor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1275P	Peptides: FoxP1(Forkhead box P1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0107P	Peptides: Beta-Amyloid (1-42) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1441P	Peptides: CXCL16 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1270P	Peptides: CK16(Cytokeratin 16) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1445P	Peptides: MLN(Motilin)peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0614P	Peptides: CULLIN (Cdc53_CUL) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1453P	Peptides: Cav-1_ETM1 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1266P	Peptides: CX36 (Connexin-36) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1257P	Peptides: FGF5 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1460P	Peptides: IL-23R(Interleukin-23 receptor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0252P	Peptides: GR (Glucocorticoid receptor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1253P	Peptides: AQP3(aquaporin 3) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0257P	Peptides: MAG-a_b (Myelin associated glycoprotein; L _ S -MAG;) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0489P	Peptides: BrdU (Bromodeoxyuridine) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0586P	Peptides: VWF (Von Willebrand Factor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0492P	Peptides: RGS2 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0106P	Peptides: Beta-Amyloid(1-40) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0105P	Peptides: Beta-Amyloid(1-28) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0104P	Peptides: Beta-Amyloid(1-16) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0102P	Peptides: M2-PK ( pyruvate Kinase M2 ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0101P	Peptides: M2-PK ( pyruvate Kinase M2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1274P	Peptides: Integrin AlphaE2_CD103 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1428P	Peptides: CLDN1(Claudin 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0226P	Peptides: Thymosin Alpha-1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0230P	Peptides: FGFR1 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1271P	Peptides: HtrA2_Omi peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1431P	Peptides: CK17(Cytokeratin 17) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0258P	Peptides: MAG (Myelin associated glycoprotein; L-MAG;MAG-a ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1368P	Peptides: SSTR3 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0169P	Peptides: Caspase-1 (ICE; CASP-1；P45) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0180P	Peptides: DDC (DOPA decarboxylase) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0590P	Peptides: Cygb (cytoglobin) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1345P	Peptides: PCX_PODXL(Podocalyxin) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1344P	Peptides: MMP-10(matrix metalloproteinase 10) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
N-20331-250	Nucleic acids: 2'-Amino-2'-deoxy-2-fluoro-adenosine, 250 mg pack	250mg	447-Eur	Jena Bio
N-20331-1G	Nucleic acids: 2'-Amino-2'-deoxy-2-fluoro-adenosine, 1 g pack	1g	1025-Eur	Jena Bio
N-20331-10G	Nucleic acids: 2'-Amino-2'-deoxy-2-fluoro-adenosine, 10 g pack	10g	6664-Eur	Jena Bio
N-20330-250	Nucleic acids: 3'-Amino-2'_3'-dideoxy-2-fluoro-adenosine, 250 mg pack	250mg	248-Eur	Jena Bio
N-20330-1G	Nucleic acids: 3'-Amino-2'_3'-dideoxy-2-fluoro-adenosine, 1 g pack	1g	542-Eur	Jena Bio
N-20330-10G	Nucleic acids: 3'-Amino-2'_3'-dideoxy-2-fluoro-adenosine, 10 g pack	10g	3442-Eur	Jena Bio
bs-1381P	Peptides: AKAP12A_SSeCKS peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1351P	Peptides: GZMB_CCPI(Granzyme B) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
BF037	Vitamino Growth Supplement (Vitamins & Amino Acids Mixture)	5x500gm	----Eur	biomarkt
bs-1359P	Peptides: DNA-PKcs peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1353P	Peptides: BECN1(Beclin1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0155P	Peptides: CRP (C-reactive protin) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0159P	Peptides: Tubulin-Alpha Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1376P	Peptides: Cx32(Connexin-32) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1377P	Peptides: MMP-26(Matrix metalloproteinase-26) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0164P	Peptides: BACE( ASP2 ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
N-PR3180-1G	Nucleic acids: 2-Amino-purine-riboside (hemihydrate), 1 g pack	1g	921-Eur	Jena Bio
N-PR3180-100	Nucleic acids: 2-Amino-purine-riboside (hemihydrate), 100 mg pack	100mg	331-Eur	Jena Bio
N-DN-1136-5G	Nucleic acids: 5-Bromo-2'-deoxy-uridine (5-BrdU), 5 g pack	5g	206-Eur	Jena Bio
N-DN-1136-25G	Nucleic acids: 5-Bromo-2'-deoxy-uridine (5-BrdU), 25 g pack	25g	1095-Eur	Jena Bio
bs-1383P	Peptides: ANPEN_CD13(Aminopeptidase N) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1340P	Peptides: FAK(Focaladhesin kinase) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1105L	Nucleic acids: Ribavirin-triphosphate, L pack Sodium Salt	100Units	331-Eur	Jena Bio
NU-1105S	Nucleic acids: Ribavirin-triphosphate, S pack Sodium Salt	20Units	133-Eur	Jena Bio
bs-1334P	Peptides: Tie1_JTK14 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0124P	Peptides: CT-R (Calcitonin receptor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0122P	Peptides: ER-Alpha peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0190P	Peptides: PACAP-27_38 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0193P	Peptides: TrK A (h-NGFR) (p140- TrK A) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1327P	Peptides: Tn-C(Tenascin-C)C-Terminus Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1409P	Peptides: HSTF2_HSF2 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1322P	Peptides: Tubulin- Gamma Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0194P	Peptides: GRP94 (gp96) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
3422-001-01	Cultrex Human Vitronectin, Nucleic Acids Reduced, PathClear	50	94-Eur	Trevigen
bs-0181P	Peptides: Nociceptin receptor Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1392P	Peptides: Cdc34 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1339P	Peptides: CK18(Cytokeratin 18) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
N-20325-250	Nucleic acids: 2-Chloro-2'-deoxy-adenosine, 250 mg pack 2-CdA, Cladribine	250mg	182-Eur	Jena Bio
N-20325-1G	Nucleic acids: 2-Chloro-2'-deoxy-adenosine, 1 g pack 2-CdA, Cladribine	1g	447-Eur	Jena Bio
N-20325-10G	Nucleic acids: 2-Chloro-2'-deoxy-adenosine, 10 g pack 2-CdA, Cladribine	10g	2873-Eur	Jena Bio
N-20323-250	Nucleic acids: 2_6-Diamino-purine 2'-deoxy-riboside, 250 mg pack	250mg	96-Eur	Jena Bio
N-20323-1G	Nucleic acids: 2_6-Diamino-purine 2'-deoxy-riboside, 1 g pack	1g	172-Eur	Jena Bio
NU-10705-10	Nucleic acids: 6-Benzylamino-purine-2'-deoxy-riboside-5'-triphosphate, 10	10	362-Eur	Jena Bio
N-20323-10G	Nucleic acids: 2_6-Diamino-purine 2'-deoxy-riboside, 10 g pack	10g	978-Eur	Jena Bio
N-20321-250	Nucleic acids: 6-Benzylamino-purine 2'-deoxy-riboside, 250 mg pack	250mg	191-Eur	Jena Bio
N-20321-1G	Nucleic acids: 6-Benzylamino-purine 2'-deoxy-riboside, 1 g pack	1g	400-Eur	Jena Bio
N-20321-10G	Nucleic acids: 6-Benzylamino-purine 2'-deoxy-riboside, 10 g pack	10g	2494-Eur	Jena Bio
bs-0120P	Peptides: Acinus peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1461P	Peptides: VDAC peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1506P	Peptides: AQP1(Aquaporin1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0036P	Peptides: phospho-CREB-1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0672P	Peptides: CD117_c-kit_SCFR Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1191P	Peptides: IL-2 (Interleukin-2)Mouse、Ret Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1186P	Peptides: CD36L1_SRB1 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1228P	Peptides: alpha Adaptin_AP1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1231P	Peptides: ABCG1 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0660P	Peptides: Cyclin D3(C-term) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-856-100	Nucleic acids: Cytidine-2':3'-cyclic monophosphate monosodium salt, 100 mg pack	100mg	128-Eur	Jena Bio
NU-856-500	Nucleic acids: Cytidine-2':3'-cyclic monophosphate monosodium salt, 500 mg pack	500mg	316-Eur	Jena Bio
bs-1465P	Peptides: GRB2_ASH peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0081P	Peptides: Caspase-3 (CPP32) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0027P	Peptides: MTR-1A (Melatonin receptor-1A) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0024P	Peptides: PS-1(NT)，Presennillin-1(S182) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0082P	Peptides: CASP4(Caspase-4) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0315P	Peptides: fgL2 (Fibrinogen-like 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0325P	Peptides: GAD-65 (glutamate decarboxylase) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1514P	Peptides: CD33_Siglec-3(mouse ret) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0076P	Peptides: Beta-Amyloid 1-42 CT Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1505P	Peptides: VASH1(Vasohibin 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0651P	Peptides: Connexin-43(Cx43) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0338P	Peptides: HGV(Hepatitis G vivus) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1497P	Peptides: CA153_MUC1_KL-6 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0052P	Peptides: Caspase-8 (pro Mch5) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0522P	Peptides: CD45(LCA_gp180) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1495P	Peptides: OCLN(Occluding) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0332P	Peptides: factor VIII Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0652P	Peptides: Connexin-45(CX45) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0051P	Peptides: Melan-A_MART-1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1215P	Peptides: TPH (Trptophan Hydroxylase) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1482P	Peptides: CD177_NB1 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1470P	Peptides: CD82_KAI1 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0622P	Peptides: Gamma-Synuclein_SNCG Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1510P	Peptides: AATK peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0529P	Peptides: IL-18_IGIF(Interleukin-18) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0300P	Peptides: MSLN(mesothelin) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0299P	Peptides: Adenylate Kinase 1 (AK-1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1542P	Peptides: CCR-6_CD196 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1540P	Peptides: IL-7Ra_CD127 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0090P	Peptides: ADM R, Adrenomedullin receptor Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0272P	Peptides: Visfatin-1 (PBEF1)(NT) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1537P	Peptides: NADPH peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1176P	Peptides: Agrin peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1169P	Peptides: CCR-1(CC chemokine receptor 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0089P	Peptides: Secretin receptor Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-843L	Nucleic acids: gamma-[(8-Aminooctyl)-imido]-2-Hydroxy-ATP, L pack	5mg	316-Eur	Jena Bio
bs-0665P	Peptides: PIWIL1(piwi-like 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0012P	Peptides: Alpha-Synuclein Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
30-555	ELOVL7 could be implicated in synthesis of very long chain fatty acids and sphingolipids.	0.1 mg	496-Eur	Prosci	cat
bs-1462P	Peptides: FLG(filaggrin)peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-843S	Nucleic acids: gamma-[(8-Aminooctyl)-imido]-2-Hydroxy-ATP, S pack	1mg	128-Eur	Jena Bio
bs-1168P	Peptides: CCR-4(C-C chemokine receptor 4) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1233P	Peptides: SHP2 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1464P	Peptides: GnRHR peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1238P	Peptides: HO-2(Heme oxygenase 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1167P	Peptides: CCR-3(CC chemokine receptor 3) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1179P	Peptides: CTLA-4_CD152 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0271P	Peptides: Cytomegalovirus (CMV)PP65 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1239P	Peptides: CA15-3 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1463P	Peptides: IFNGR1_CD119 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1194P	Peptides: NF-KapBp50(p50 NF-kappa B;p50NFKB) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
DAG276	Recombinant Human pro-Brain Natriuretic Peptide (proBNP) (amino acids 1–108)	50ug	1694-Eur	CDiagnostic
DAG573	Recombinant Hepatitis B Virus (HBV) Core Antigen (HBcAg)(amino acids 1–183)	0.5mg	913-Eur	CDiagnostic
bs-2082P	Peptides: p-Caldesmon(phosphor-Ser789) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2075P	Peptides: HO-1_HSP32(Hemeo xygenase 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
LIP	Lipolysis Assay KIT , Dual Glycerol and free fatty acids Detection (REAGENTS ONLY)	kit	862-Eur	ZenBio	elisa
bs-1366P	Peptides: NF2_merlin(neurofibromatosis type 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CSB-EL007623RA	Rat Elongation of very long chain fatty acids protein 5(ELOVL5) ELISA kit	96T	626-Eur	Cusabio	Elisa kits
bs-1404P	Peptides: IRF-1(Interferon regulatory factor-1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0955P	Peptides: CBX5(Chromobox Homolog 5) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1370P	Peptides: ATM(ataxia telangiectasia mutated) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1403P	Peptides: USF-1(upstream stimulatory factor 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2062P	Peptides: FPP(Fertilization Promoting Peptide) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0469P	Peptides: C-fos(i mmediate early gene, ieg) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2165P	Peptides: Defensin Beta1(human) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2066P	Peptides: phospho-GSK-3 Beta(pSer9) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1401P	Peptides: SRF(Serum response factor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CSB-EL007624RA	Rat Elongation of very long chain fatty acids protein 6(ELOVL6) ELISA kit	96T	626-Eur	Cusabio	Elisa kits
DAG274	Recombinant Human pro-Brain Natriuretic Peptide (proBNP) (amino acids 1-76)	50ug	1870-Eur	CDiagnostic
bs-2105P	Peptides: AD7C-NTP_NTP_AF peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0913P	Peptides: Mtp53(Mutant type p53) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2145P	Peptides: Hrasls3_HREV107(HRAS like suppressor 3) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2107P	Peptides: T7 tag(recombinant T7-tagged proteins) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-0533P	Peptides: GABAB1(GABAb Receptor 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1178P	Peptides: PAR-2 (Protease-activated receptors-2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1342P	Peptides: NRF-1(nuclear respiratory factor-1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0918P	Peptides: ShK(Stichodactyla helianthus Neurotoxin) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1526P	Peptides: Laminin Beta1 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1184P	Peptides: TRAF6 (TNF receptor-associated factor 6) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
TM 500	YEAST NITROGEN BASE W_O AMINO ACIDS AND AMMONIUM SULPHATE (Store below 8º C) (for classification of yea	100 gm	105-Eur	TitanBiotech	cat
bs-0922P	Peptides: NGN3(neurogenin 3; Neurog3) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0473P	Peptides: solute carrier family 1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1648P	Peptides: phospho-ATF2(pSer490_pSer498) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
LIP	Lipolysis Assay KIT, Free Fatty Acids Detection (5 plates; REAGENTS + BUFFERS ONLY)	kit	2454-Eur	ZenBio	elisa
DAG272	Recombinant Human pro-Brain Natriuretic Peptide (proBNP), (amino acids 1-108)	10ug	1116-Eur	CDiagnostic
bs-0905P	Peptides: Acetylated-P53(Lys382) peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1568P	Peptides: ENPP3_CD203c(ectonucleotide pyrophosphatase_phosphodiesterase 3) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1696P	Peptides: DR5_TNFRSF10B_CD262 (Death receptor 5) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1138P	Peptides: SSTR2 (somatostatin receptor 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1198P	Peptides: HLA-DR(human leukoyte Antigen DR) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1139P	Peptides: SSTR5 (somatostatin receptor 5) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1197P	Peptides: TLR5_CD285 (Toll-like receptor 5) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2098P	Peptides: ER- Alpha_ER alpha peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0942P	Peptides: WIG-1(wtp53-induced gene 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1188P	Peptides: FRA2_FOSL2(Fos related_like antigen 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0527P	Peptides: CD10_CALLA (Neutral Endopeptidase) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1508P	Peptides: cath-L_CL peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
TM 500	YEAST NITROGEN BASE W_O AMINO ACIDS AND AMMONIUM SULPHATE (Store below 8º C) (for classification of yea	100 gm	105-Eur	TitanBiotech	cat
bs-1243P	Peptides: Trop-2_Tpm2 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1742P	Peptides: CYP3A4(Cytochrome p450 3A4) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1740P	Peptides: IL-4(Interleukin-4)human peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
K-CF0007	Main Filters for CT1800, Type: ACID, Purpose: Mineral Acids		349-Eur	Monmouth Scientific
bs-1280P	Peptides: TCF7L2(transcription factor 7-like 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0497P	Peptides: Dnmt3a(cytosine-5)-methyltransferase 3A) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0465P	Peptides: NFKBp65(p65 NF-kappa B;p65NFKB) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1036P	Peptides: CD62L (ELAM-1_L-Selectin ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1064P	Peptides: Klf4 (Kruppel likefactor 4) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1027P	Peptides: NSE (neuron specific enolase) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
K-CF0081	Circulaire Main filters, type: ACID, Purpose: Mineral Acids		313-Eur	Monmouth Scientific
K-CF0018	Main Filters for CT1800, Type: ACID, Purpose: Mineral Acids		313-Eur	Monmouth Scientific
bs-1025P	Peptides: HGF(hepatocyte growth factor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1201P	Peptides: PAX8(Paired box gene 8) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
K-CF0018	Main Filters for CT1100, Type: ACID, Purpose: Mineral Acids		313-Eur	Monmouth Scientific
bs-1284P	Peptides: Bak(BCL2 homologous antagonist_killer) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1080P	Peptides: SOD2 (superoxide-dimutase-2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CSD-200	SiMax™ Spin Column with Silica Membrane Nucleic Acids Isolation & Purification	200 ea	152-Eur	SBS
BQ042A-EALD	LIVER DISEASES Total Bile Acids (TBA) (Enzymatic Cycling) Kit	430 Tests / Kit	514-Eur	Bioquant	assays
bs-1763P	Peptides: EphA1 R(Ephrin A1 Receptor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
Inquire	Peptide synthesis, HPLC Purity 80%, number of amino acids 8_30	2 mg/5 mg/10 mg/15 mg/20 mg	----Eur	Emp Biotech
bs-1069P	Peptides: proCNP_NPPC (pro-natriuretic peptide) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1070P	Peptides: NPY1R (neuropeptide Y1 receptor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0482P	Peptides: Gastrin(human)peptide(1-17) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0486P	Peptides: integrin Beta1(ITG- Beta1_CD29) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0463P	Peptides: MMP-1(Mous ematrix metalloproteinases-1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1444P	Peptides: TLR3 (Toll-like receptor 3) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
Inquire	Peptide synthesis, HPLC Purity 95%, number of amino acids 8_31	2 mg/5 mg/10 mg	----Eur	Emp Biotech
bs-1774P	Peptides: Inhibin beta A peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1789P	Peptides: IL-12(Interleukin-12)human peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1746P	Peptides: DRD4 receptor peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1076P	Peptides: Egr-1(Early growth response 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1079P	Peptides: SOD1(superoxide-dimutase-1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-522	Nucleic acids: Etheno-AP2(Nic) [epsilon-AP2(Nic)], pack (Nicotinamide 1,N6-ethano-adenine dinucleotide)	300Units	933-Eur	Jena Bio
bs-1022P	Peptides: MUC5AC_Mucin 5AC(Gastric Mucin M1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1021P	Peptides: TLR4_CD284 (Toll-like receptor 4) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1009P	Peptides: CXCR1 (CXC-chemokine receptor 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0545P	Peptides: SCF (Stem Cell Factor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1468P	Peptides: MDR1(multidrug resistance 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0975P	Peptides: TSFP1_SP1(transcription factor Sp1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1304P	Peptides: Bad (BCL-xL_BCL-2-associated death promoter) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1213P	Peptides: TRAF2_TNF-R2 (TNF receptor-associated factor 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
HSP05025	Hsp104(amino acids 1_908) Saccharomyces cerevisiae Source Recombinant	1 mg	1355-Eur	Assaypro	recombinant
bs-2040P	Peptides: ANP(atrial natriuretic peptide) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0498P	Peptides: Beta1-adrenergic receptor Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2042P	Peptides: CD33 peptide(human) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1308P	Peptides: XAF1(XIAP-associated factor 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1414P	Peptides: HDAC1_HD1(histone deacetylase 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1207P	Peptides: GLUT3(Glucose transporter 3) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0963P	Peptides: MTNR1B_MTNR-1B(Melatonin receptor 1B) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1500P	Peptides: cath-B_CB(Cathepsin B) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0455P	Peptides: HSL(hormone-sensitive lipase) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1503P	Peptides: CXCL14(CXC-chemokine ligand 16) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0535P	Peptides: TFF3 (trefoil factor3) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2010P	Peptides: EGF(Epidermal growth factor)rat Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1102P	Peptides: PAX9(Paired box gene 9) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
K-CF0055	Outlet Filters for CT1800, Type: ACID, Purpose: Mineral Acids		159-Eur	Monmouth Scientific
K-CF0055	Outlet Filters for CT1100, Type: ACID, Purpose: Mineral Acids		159-Eur	Monmouth Scientific
bs-1286P	Peptides: CD40L(CD40 Ligand_TNFSF5_CD154) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1007P	Peptides: DAD1 (dopamine D1 receptor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0995P	Peptides: ADM (Adrenomedullin)ProAM-N20 Rat, human, mo, pig, dog, bov Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
29-917	SLC7A4 is involved in the transport of the cationic amino acids (arginine, lysine and ornithine).	0.05 mg	632-Eur	Prosci	cat
bs-1290P	Peptides: Cyr61_IGFBP10_CCN1(cysteine rich 61) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0983P	Peptides: EV71(Human enterovirus 71)VP1(CT) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1226P	Peptides: GPA33(glycoprotein A33 transmembrane) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1293P	Peptides: GABABR2_GB2(GABA B Receptor 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1225P	Peptides: ADORA3_A3AR(adenosine receptor A3) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
LIP	Lipolysis Assay KIT, Dual Glycerol and free fatty acids Detection (REAGENTS ONLY for 5	kit	3469-Eur	ZenBio	elisa
bs-0826P	Peptides: TTF-1 (Thyroid Transcription Factor-1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0801P	Peptides: ARIP2B(Activin receptor 2B) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0629P	Peptides: SULT1E1(Estrogen Sulfotranferase) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CSB-EQ027300CH	Chicken free fatty acids(FFA) ELISA kit , Species , Sample Type	96T	913-Eur	Cusabio	elisa
N-10503-1G	Nucleic acids: 2'-Fluoro-2'-deoxy-arabinofuranosyl-guanine, 1 g pack 2'-FANA-G	1g	1054-Eur	Jena Bio
N-10501-500	Nucleic acids: 2'-Fluoro-2'-deoxy-arabinofuranosyl-adenine, 500 mg pack 2'-FANA-A	500mg	551-Eur	Jena Bio
bs-0222P	Peptides: NR2B (Glutamate receptor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
N-10501-250	Nucleic acids: 2'-Fluoro-2'-deoxy-arabinofuranosyl-adenine, 250 mg pack 2'-FANA-A	250mg	314-Eur	Jena Bio
bs-0242P	Peptides: IRS P53 (Insulin receptor substrate P53)(多肽) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0430P	Peptides: DISC1(disrupted in schizophrenia1)(CT) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0799P	Peptides: CTn1 (cardiac troponin 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0428P	Peptides: DISC1(disrupted in schizophrenia1)(NT) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
DNJ3001	Heat shock proteins (Chaperonins): DnaJ (Amino acids 1-376), E.coli	0.5mg	478-Eur	ATGen	Proteins
bs-0790P	Peptides: CLDN1(Claudin 1)C-term Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-4814P	Proteins: Newcastle disease virus Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-4814P-HRP	Proteins: Newcastle disease virus_HRP Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
N-10503-250	Nucleic acids: 2'-Fluoro-2'-deoxy-arabinofuranosyl-guanine, 250 mg pack 2'-FANA-G	250mg	343-Eur	Jena Bio
N-10503-500	Nucleic acids: 2'-Fluoro-2'-deoxy-arabinofuranosyl-guanine, 500 mg pack 2'-FANA-G	500mg	599-Eur	Jena Bio
bs-0098P	Peptides: GIP (Gastric Inhibitory polypeptide) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
BQ 042A-EALD	Total Bile Acids (TBA) (Enzymatic Cycling, liquid stable	430/kit	515-Eur	Bioquant
NU-1603S	Nucleic acids: d4TMP, S pack Stavudine monophosphate, Sodium Salt	20Units	128-Eur	Jena Bio
bs-2940P	Peptides: FUCA1_Alpha L fucosidase I peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
N-10506-250	Nucleic acids: 2'-Fluoro-2'-deoxy-arabinofuranosyl-uracil, 250 mg pack 2’-FANA-U	250mg	106-Eur	Jena Bio
N-10506-1G	Nucleic acids: 2'-Fluoro-2'-deoxy-arabinofuranosyl-uracil, 1 g pack 2’-FANA-U	1g	276-Eur	Jena Bio
bs-0635P	Peptides: SSA_RO (ribonucleoprotein complex,RNP) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
01-2231	Antigens Hsp104(amino acids 1-908) Saccharomyces cerevisiae, Recombinant, E.coli	20	259-Eur	ARP
SMC-318D	Cavbeta4, S10-7 Monoclonals AntibodiesS10-7 Synthetic peptide amino acids 458-474 of rat CavB4	100ug	324-Eur	Stressmarq
DNJ3001	Heat shock proteins (Chaperonins): DnaJ (Amino acids 1-376), E.coli	100ug	226-Eur	ATGen	Proteins
bs-0433P	Peptides: ADAMTS-7(a disintegrin-like and metalloprotease-7 ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
N-10504-500	Nucleic acids: 2'-Fluoro-2'-deoxy-arabinofuranosyl-hypoxanthin, 500 mg pack 2'-FANA-I	500mg	570-Eur	Jena Bio
NU-1603L	Nucleic acids: d4TMP, L pack Stavudine monophosphate, Sodium Salt	100Units	316-Eur	Jena Bio
N-10504-250	Nucleic acids: 2'-Fluoro-2'-deoxy-arabinofuranosyl-hypoxanthin, 250 mg pack 2'-FANA-I	250mg	333-Eur	Jena Bio
bs-0804P	Peptides: ARIP2a(Activin receptor 2A) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
N-10504-1G	Nucleic acids: 2'-Fluoro-2'-deoxy-arabinofuranosyl-hypoxanthin, 1 g pack 2'-FANA-I	1g	1006-Eur	Jena Bio
bs-0292P	Proteins: BSA (bovine serum albumin) Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
N-10501-1G	Nucleic acids: 2'-Fluoro-2'-deoxy-arabinofuranosyl-adenine, 1 g pack 2'-FANA-A	1g	978-Eur	Jena Bio
bs-0077P	Peptides: VIP (Vasoactive Intestinal peptide) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
HSP05022	Hsp104(amino acids 1_908) Saccharomyces cerevisiae Source Recombinant	0.2 mg	391-Eur	Assaypro	recombinant
bs-0732P	Peptides: COX-2 (Prostaglandin-endoperoxide synthase-2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
HSP0501	HSP90 (amino acids 1_732), Human, Recombinant, His_tag, E.coli	1mg	803-Eur	ATGen	recombinant
HSP0502	Hsp104(amino acids 1_908) Saccharomyces cerevisiae, Recombinant, E.coli	1mg	761-Eur	ATGen	recombinant
bs-0770P	Peptides: SP-A (pulmonary surfactant-associated glycoprotein A) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
PM-109	Nucleic acids: A3804 hyg forward primer(for integration diagnostics of all hyg expression vectors)	2,5nmol	56-Eur	Jena Bio
N-10506-500	Nucleic acids: 2'-Fluoro-2'-deoxy-arabinofuranosyl-uracil, 500 mg pack 2’-FANA-U	500mg	163-Eur	Jena Bio
bs-0323P	Peptides: NR2A (Glutamate receptor2A) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
PM-103	Nucleic acids: F2999 sat forward primer(for integration diagnostics of all sat expression vectors)	2,5nmol	56-Eur	Jena Bio
PM-108	Nucleic acids: A1432 neo forward primer(for integration diagnostics of all neo expression vectors)	2,5nmol	56-Eur	Jena Bio
PM-107	Nucleic acids: A708 ble forward primer(for integration diagnostics of all ble expression vectors)	2,5nmol	56-Eur	Jena Bio
bs-0357P	Peptides: TRH (Thyrotropin releasing hormone ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0240P	Peptides: OGP (Ostegenic Growth Peptide) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0609P	Peptides: OAT-3(Organic anion transporter 3) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0610P	Peptides: Adipo R1(adiponectin receptor 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2005P	Proteins: rDen(rh-Dengue Virus) Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-0611P	Peptides: Adipo R2(adiponectin receptor 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1602S	Nucleic acids: AzTTP, S pack Zidovudine triphosphate, Sodium Salt	10Units	128-Eur	Jena Bio
bs-0225P	Proteins: KLH (keyhole limpet hemocyanin) Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-0596P	Peptides: DBH (Dopamine- Beta-Hydroxylase) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1602L	Nucleic acids: AzTTP, L pack Zidovudine triphosphate, Sodium Salt	50Units	316-Eur	Jena Bio
bs-0109P	Peptides: Leptin receptor(long) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0719P	Peptides: CEA(Carcinoembryonic Antigen )peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
Y-0120	Peptides: A Beta29-40( Beta-Amyloid 29-40) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
Y-0121	Peptides: A Beta29-42( Beta-Amyloid 29-42) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0584P	Peptides: PEPT2 (Peptide-transporters 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0074P	Peptides: NIK，NF-kappaB-Inducing Kinase Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1601S	Nucleic acids: AzTMP, S pack Zidovudine monophosphate, Sodium Salt	20Units	128-Eur	Jena Bio
NU-1601L	Nucleic acids: AzTMP, L pack Zidovudine monophosphate, Sodium Salt	100Units	316-Eur	Jena Bio
bs-2298P	Proteins: rDen-2(rh-Dengue Virus) Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-0421P	Peptides: DR3_TRAMP (death receptor-3) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0862P	Proteins: Insulin (from porcine pancreas) Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-2122P	Proteins: r-GST(Recombinant Glutathione S-T Ahents) Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-0270P	Peptides: Visfatin-1 (PBEF1)(NT) Human Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0579P	Peptides: CD105_Endoglin_TGF- Beta receptor Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0011P	Peptides: GRP( Gastrin Releasing Peptide ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0758P	Peptides: MSH2 (mutS homolog 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1604S	Nucleic acids: d4TTP, S pack Stavudine triphosphate, Sodium Salt	10Units	128-Eur	Jena Bio
N-20328-250	Nucleic acids: 2'-Amino-2'-deoxy-2_6-diamino-purine-riboside, 250 mg pack	250mg	276-Eur	Jena Bio
N-20328-1G	Nucleic acids: 2'-Amino-2'-deoxy-2_6-diamino-purine-riboside, 1 g pack	1g	599-Eur	Jena Bio
N-20328-10G	Nucleic acids: 2'-Amino-2'-deoxy-2_6-diamino-purine-riboside, 10 g pack	10g	3821-Eur	Jena Bio
bs-0037P	Peptides: AIF　(Apoptosis-Inducing Factor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
N-20320-250	Nucleic acids: Arabinofuranosyl-6-benzylamino-purine, 250 mg pack 6-Benzylaminopurine arabinoside	250mg	191-Eur	Jena Bio
bs-0747P	Peptides: OPGL (Osteoprotegerin ligand) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
N-20320-1G	Nucleic acids: Arabinofuranosyl-6-benzylamino-purine, 1 g pack 6-Benzylaminopurine arabinoside	1g	400-Eur	Jena Bio
bs-2241P	Peptides: PSAP_PAP peptide (human) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0582P	Peptides: COX-1 (Prostaglandin-endoperoxide synthase-1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
N-20320-10G	Nucleic acids: Arabinofuranosyl-6-benzylamino-purine, 10 g pack 6-Benzylaminopurine arabinoside	10g	2494-Eur	Jena Bio
N-20318-250	Nucleic acids: 2'-Fluoro-2'-deoxy-2_6-diamino-purine-riboside, 250 mg pack	250mg	220-Eur	Jena Bio
N-20318-1G	Nucleic acids: 2'-Fluoro-2'-deoxy-2_6-diamino-purine-riboside, 1 g pack	1g	485-Eur	Jena Bio
bs-0382P	Peptides: CRF (Corticotropin-Releasing Factor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2219P	Peptides: pectinesterase inhibitor 18 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0277P	Peptides: Tanis_SELS (Selenoprotein S)又称SELS Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0892P	Peptides: Bad (BCL-xL_BCL-2-associated death promoter) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
SMC-356D	PSD-95, S28-43 Monoclonals AntibodiesS28-43 Fusion protein amino acids 77-200 of human PSD95_SAP90	100ug	324-Eur	Stressmarq
bs-0688P	Peptides: Nm23(NDP Kinase A,NDPKA) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0016P	Peptides: TY3H ( Tyrosine Hydroxylase ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0278P	Peptides: RRAD (Ras-related associated with diabetes ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2184P	Peptides: NQO1(NAD(P)H:quinone oxidoreductase l) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0015P	Peptides: IGF-II( Insulin-like Growth Factor-II ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0589P	Peptides: WWOX (WW domain-containing oxidoreductase) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
01-2276	Antigens HSP70 (amino acids 1-641) Human, Recombinant, His- tagged, E.coli	5	226-Eur	ARP
bs-0163P	Peptides: NOS-3 (eNOS) endotheli cell NOS Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0096P	Peptides: AAT(Alpha-1Anti-tiypsin) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0246P	Peptides: CRF (Corticotropin-Releasing Factor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0014P	Peptides: IGF-I( Insulin-like Growth Factor-I ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0591P	Peptides: DR4_APO2_TRAILR1 (Death receptor 4) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2217P	Peptides: Integrin alpha E2 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
N-20318-10G	Nucleic acids: 2'-Fluoro-2'-deoxy-2_6-diamino-purine-riboside, 10 g pack	10g	3063-Eur	Jena Bio
N-20312-250	Nucleic acids: 3'-Amino-2'_3'-dideoxy-2_6-diamino-purine-riboside, 250 mg pack	250mg	115-Eur	Jena Bio
bs-0852P	Peptides: EV71(Human enterovirus 71)VP1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0004P	Peptides: ACTH (Adrenorticotrophin hormons)(7-23) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2478P	Peptides: CCL12_MCP-5(C-C motif chemokine 12) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
HSP0501	HSP90 (amino acids 1_732), Human, Recombinant, His_tag, E.coli	100ug	277-Eur	ATGen	recombinant
bs-0847P	Peptides: HBA1(hemoglobin alpha 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2479P	Peptides: CCL14_HCC-1(C-C motif chemokine 14) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1604L	Nucleic acids: d4TTP, L pack Stavudine triphosphate, Sodium Salt	50Units	316-Eur	Jena Bio
bs-0043P	Peptides: CAD(Caspase-Activated Deoxyribonuclease) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0837P	Peptides: GSR_GRase(glutathione reductase) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1137P	Proteins: SSTR1 (somatostatin receptor 1) Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-0409P-FITC	Peptides: Leptin peptide_FITC Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0689P	Peptides: PEPT1 (Peptide-transporters 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
BQ 042A-EALD	LIVER DISEASES-Total Bile Acids (TBA) (Enzymatic Cycling) Kit	430	522-Eur	Smart Serology	assays
bs-0624P	Peptides: CD272_BTLA(B and T lymphocyte attenuator) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0828P	Peptides: PAR-1 (Protease-activated receptors-1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
HSP0502	Hsp104(amino acids 1_908) Saccharomyces cerevisiae, Recombinant, E.coli	100ug	226-Eur	ATGen	recombinant
bs-0654P	Peptides: GHR (growth hormone receptor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
N-20306-10G	Nucleic acids: Arabinofuranosyl-2_6-diamino-purine, 10 g pack 2,6-diaminopurine arabinoside	10g	599-Eur	Jena Bio
N-20312-1G	Nucleic acids: 3'-Amino-2'_3'-dideoxy-2_6-diamino-purine-riboside, 1 g pack	1g	229-Eur	Jena Bio
bs-0861PK	Peptides: 2,4-D_KLH(2,4-Dichlorophenoxyacetic acid) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2353P	Peptides: Mast Cell Chymase Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
N-20312-10G	Nucleic acids: 3'-Amino-2'_3'-dideoxy-2_6-diamino-purine-riboside, 10 g pack	10g	1357-Eur	Jena Bio
bs-0685P	Peptides: SYK (Spleen tyrosine kinase) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
PM-101	Nucleic acids: A264 insert sequencing reverse primer(for all expression vectors)	2,5nmol	56-Eur	Jena Bio
bs-0118P	Peptides: AR (Androgen Receptor)peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0443P	Peptides: ACTH (Adrenorticotrophin hormons)(1-39) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0042P	Peptides: ChAT(Choline Acetyltransferase) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0567P	Peptides: Integrin Alpha5(ITG- AlphaV_CD49e) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
N-20306-1G	Nucleic acids: Arabinofuranosyl-2_6-diamino-purine, 1 g pack 2,6-diaminopurine arabinoside	1g	115-Eur	Jena Bio
bs-2430P	Peptides: Apelin receptor_APJ receptor Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
N-20306-250	Nucleic acids: Arabinofuranosyl-2_6-diamino-purine, 250 mg pack 2,6-diaminopurine arabinoside	250mg	68-Eur	Jena Bio
bs-0442P	Peptides: ACTH (Adrenorticotrophin hormons)(18-39) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0827P	Peptides: HO-1_HSP32 (Hemeo xygenase 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0518P	Peptides: ATF2 (Activating Transcription Factor2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0280P	Peptides: PLGF (Placenta growth factor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0028P	Peptides: GSK-3 Beta, (Glycogen Synthase Kinase-3) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1234P	Peptides: RASSF1A(Ras association domain family 1A) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1006L	Nucleic acids: dNTP Mix _ 10 mM, L pack Premix of 10 mM dATP, dCTP, dGTP and dTTP	1ml	96-Eur	Jena Bio
SMC-377D	Kv4.3 K+ channel, S75-41 Monoclonals AntibodiesS75-41 Fusion protein amino acids 415-636 (cytoplasmic C-temrinus) of rat Kv4.3	100ug	324-Eur	Stressmarq
DAG273	Recombinant Human pro-Brain Natriuretic Peptide (proBNP), N-terminal (amino acids 1-76)	10ug	1033-Eur	CDiagnostic
bs-0478P	Peptides: SLC6A4 (solute carrier family 6) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1522P	Peptides: phospho-ERK1_MAPK-1_2(pThr183 + pTyr185) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1202P	Peptides: TRADD(TNF receptor 1 associated via death domain) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0031P	Peptides: BTG2_TIS21(B-cell translocation gene 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1196P	Peptides: PAR4 (protease-activated receptor 4) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0342P	Peptides: Integrin Beta chain (ITG- Beta3_ITGB3) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1192P	Peptides: CD14(cluster of differentiation antigen 14) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0351P	Peptides: GLUT2(Glucose transporter type 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1190P	Peptides: ECE1(Endothelin Converting Enzyme 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
SMC-366D	CASK. S56A-50 Monoclonals AntibodiesS56A-50 Fusion protein amino acids 318-415 of rat CASK_Lin2	100ug	324-Eur	Stressmarq
bs-0592P	Peptides: DCC (Deleted in colorectal cancer gene) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1206P	Peptides: GLI1(GLI-Kruppel family member 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0638P	Peptides: TGF- BetaR1_ALK (TGF-beta receptor type I) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
SPC-164D	BIM_BOD (IN2) Polyclonals Ab, Host Rabbit Internal central amino acids of human Bim	100ug	324-Eur	Stressmarq
SPC-164C	BIM_BOD (IN2) Polyclonals Ab, Host Rabbit Internal central amino acids of human Bim	25ug	181-Eur	Stressmarq
SPC-113D	BIM_BOD (IN) Polyclonals Ab, Host Rabbit Internal central amino acids of human Bim	100μg	291-Eur	Stressmarq
SPC-113C	BIM_BOD (IN) Polyclonals Ab, Host Rabbit Internal central amino acids of human Bim	25μg	157-Eur	Stressmarq
bs-1256P	Peptides: FGF4_HSTF1_HBGF-4(Fibroblast Growth Factor4) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1480P	Peptides: Rho C(Ras homolog gene family member C) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0580P	Peptides: Socs 3 (suppressor of cytokine signaling 3) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1490P	Peptides: ShK(Stichodactyla helianthus Neurotoxin)-(Ala22) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1218P	Peptides: XRCC1(X-ray Repair Cross Complementing 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1491P	Peptides: ShK(Stichodactyla helianthus Neurotoxin)-(Arg22) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1492P	Peptides: ShK(Stichodactyla helianthus Neurotoxin)-(Dap22) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0630P	Peptides: AT1R(Angiotensin II Type 1 Receptor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0633P	Peptides: CDK4(Cyclin Dependent Kinase 4) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0519P	Peptides: ATF3 (Activating Transcription Factor3) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1250P	Peptides: Gax(growth arrest-specific homeobox) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1005S	Nucleic acids: dNTP Bundle, S pack 4x 100 mM (dATP, dCTP, dGTP, dTTP)	4 x 200	67-Eur	Jena Bio
CSB-EL007625MO	Mouse Elongation of very long chain fatty acids protein 7(ELOVL7) ELISA kit	96T	626-Eur	Cusabio	Elisa kits
CSB-EL007624MO	Mouse Elongation of very long chain fatty acids protein 6(ELOVL6) ELISA kit	96T	626-Eur	Cusabio	Elisa kits
bs-0113P	Peptides: Socs 1 (suppressor of cytokine signaling 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
N-10512-500	Nucleic acids: 2'-Fluoro-2'-deoxy-arabinofuranosyl-6-thioguanine, 500 mg pack 2'-FANA-ThioG	500mg	883-Eur	Jena Bio
N-10512-250	Nucleic acids: 2'-Fluoro-2'-deoxy-arabinofuranosyl-6-thioguanine, 250 mg pack 2'-FANA-ThioG	250mg	504-Eur	Jena Bio
CSB-EL007623MO	Mouse Elongation of very long chain fatty acids protein 5(ELOVL5) ELISA kit	96T	626-Eur	Cusabio	Elisa kits
N-10512-1G	Nucleic acids: 2'-Fluoro-2'-deoxy-arabinofuranosyl-6-thioguanine, 1 g pack 2'-FANA-ThioG	1g	1565-Eur	Jena Bio
NU-1006S	Nucleic acids: dNTP Mix _ 10 mM, S pack Premix of 10 mM dATP, dCTP, dGTP and dTTP	200	46-Eur	Jena Bio
CSB-EL007622MO	Mouse Elongation of very long chain fatty acids protein 4(ELOVL4) ELISA kit	96T	626-Eur	Cusabio	Elisa kits
bs-1298P	Peptides: Smac_DIABLO(the second mitochondrial activator of caspase) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0517P	Peptides: ATF1 (Activating Transcription Factor1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CSB-EL007621MO	Mouse Elongation of very long chain fatty acids protein 3(ELOVL3) ELISA kit	96T	626-Eur	Cusabio	Elisa kits
CSB-EL007620MO	Mouse Elongation of very long chain fatty acids protein 2(ELOVL2) ELISA kit	96T	626-Eur	Cusabio	Elisa kits
bs-1291P	Peptides: ING1_p33(inhibitor of growth gene 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
N-10505-250	Nucleic acids: 2'-Fluoro-2'-deoxy-arabinofuranosyl-cytosine hydrochloride, 250 mg pack 2'-FANA-C	250mg	163-Eur	Jena Bio
N-10505-1G	Nucleic acids: 2'-Fluoro-2'-deoxy-arabinofuranosyl-cytosine hydrochloride, 1 g pack 2'-FANA-C	1g	466-Eur	Jena Bio
CSB-EL007619MO	Mouse Elongation of very long chain fatty acids protein 1(ELOVL1) ELISA kit	96T	626-Eur	Cusabio	Elisa kits
bs-1320P	Peptides: ShK(Stichodactyla helianthus Neurotoxin)-(Gln9) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1321P	Peptides: ShK(Stichodactyla helianthus Neurotoxin)-(Gln11) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1005L	Nucleic acids: dNTP Bundle, L pack 4x 100 mM (dATP, dCTP, dGTP, dTTP)	4 x 1ml	179-Eur	Jena Bio
bs-1363P	Peptides: Iba-1(Ionized calcium bindingadaptor molecule-1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CSB-EL007624CH	Chicken Elongation of very long chain fatty acids protein 6(ELOVL6) ELISA kit	96T	710-Eur	Cusabio	Elisa kits
bs-0588P	Peptides: PALB2(partner and locaizer of BRCA2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1354P	Peptides: Apo J_Clusterin- Alpha_ Beta(Apolipoprotein J) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CSB-RP133474h	Recombinant human Large neutral amino acids transporter small subunit 3	500ug	782-Eur	Cusabio
bs-1352P	Peptides: Mcl-1(myeloid cell leukemia 1) peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0165P	Peptides: EGF-R (Epidemal growth factor receptor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1019L	Nucleic acids: ddNTP bundle, L pack 4x 10 mM (ddATP, ddCTP, ddGTP, ddTTP)	4 x 500	500-Eur	Jena Bio
NU-1019S	Nucleic acids: ddNTP bundle, S pack 4x 10 mM (ddATP, ddCTP, ddGTP, ddTTP)	4 x 100	134-Eur	Jena Bio
CSB-EL007625BO	Bovine Elongation of very long chain fatty acids protein 7(ELOVL7) ELISA kit	96T	710-Eur	Cusabio	Elisa kits
NU-1023L	Nucleic acids: dNTP Mix _ 25 mM, L pack Premix of 25 mM dATP, dCTP, dGTP and dTTP	1ml	157-Eur	Jena Bio
CSB-EL007623BO	Bovine Elongation of very long chain fatty acids protein 5(ELOVL5) ELISA kit	96T	710-Eur	Cusabio	Elisa kits
CSB-EL021721RA	Rat Large neutral amino acids transporter small subunit 2(SLC7A8) ELISA kit	96T	626-Eur	Cusabio	Elisa kits
NU-1023S	Nucleic acids: dNTP Mix _ 25 mM, S pack Premix of 25 mM dATP, dCTP, dGTP and dTTP	200	62-Eur	Jena Bio
CSB-EL021717RA	Rat Large neutral amino acids transporter small subunit 1(SLC7A5) ELISA kit	96T	626-Eur	Cusabio	Elisa kits
bs-1336P	Peptides: Bcl-xL(human, mo, rat, bovine, dog, pig, sheep, horse) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1288P	Peptides: GDF8_MSTN(growth differntiation factor 8) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
K-CF0196	MAIN FILTERS FOR CFS800 Cabinet, type: ACID, Purpose: Mineral Acids		142-Eur	Monmouth Scientific
bs-0234P	Peptides: PLGF (Placenta growth factor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CSB-EL007625HU	Human Elongation of very long chain fatty acids protein 7(ELOVL7) ELISA kit	96T	626-Eur	Cusabio	Elisa kits
CSB-EL007624HU	Human Elongation of very long chain fatty acids protein 6(ELOVL6) ELISA kit	96T	626-Eur	Cusabio	Elisa kits
bs-0236P	Peptides: ChRM2 (Muscarinic Acetylcholine receptor M2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CSB-EL007623HU	Human Elongation of very long chain fatty acids protein 5(ELOVL5) ELISA kit	96T	626-Eur	Cusabio	Elisa kits
bs-0612P	Peptides: BADH2 (Betaine-aldehyde dehydrogenase ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0613P	Peptides: Eukaryotic aspartyl protease(Rice) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CSB-EL007622HU	Human Elongation of very long chain fatty acids protein 4(ELOVL4) ELISA kit	96T	626-Eur	Cusabio	Elisa kits
bs-0585P	Peptides: Smad4(Mothers against decapentaplegic homolog 4) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CSB-EL007621HU	Human Elongation of very long chain fatty acids protein 3(ELOVL3) ELISA kit	96T	626-Eur	Cusabio	Elisa kits
CSB-EL007620HU	Human Elongation of very long chain fatty acids protein 2(ELOVL2) ELISA kit	96T	626-Eur	Cusabio	Elisa kits
N-10505-500	Nucleic acids: 2'-Fluoro-2'-deoxy-arabinofuranosyl-cytosine hydrochloride, 500 mg pack 2'-FANA-C	500mg	267-Eur	Jena Bio
bs-1267P	Peptides: MYOZ_MYOZ1(Myozenin)human、ret、mouse Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
42-019	TNKS Antibody. Fusion protein containing 120aa amino acids from N Terminal region (according to NP_003738.2)	0.1 mg	482-Eur	Prosci
bs-0097P	Peptides: ALK (Anaplastic Lymphoma Kinase)(CD246Ag) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CSB-EL007619HU	Human Elongation of very long chain fatty acids protein 1(ELOVL1) ELISA kit	96T	626-Eur	Cusabio	Elisa kits
bs-0094P	Peptides: AACT(Alpha-1-Anti-chymotrypsin) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1272P	Peptides: CNTF(Ciliary Neurotrophic Factor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0224P	Peptides: N-coR1 (Nuclear receptor co-repressor 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
K-CF0067	Outlet Filters for CT800/CT1400, Type: ACID, Purpose: Mineral Acids		172-Eur	Monmouth Scientific
K-CF0067	Outlet Filters for Circulaire 1400EX, Type:ACID, Purpose: Mineral Acids		172-Eur	Monmouth Scientific
K-CF0144	Main Filters for Circulaire 550 cabinet, type: ACID, purpose: Mineral Acids		313-Eur	Monmouth Scientific
K-CF0081	Main Filters for Circulaire 650 cabinet, type: ACID, purpose: Mineral Acids		313-Eur	Monmouth Scientific
K-CF0018	Main Filters for Circulaire 1100EX, Type:ACID, Purpose: Mineral Acids		313-Eur	Monmouth Scientific
bs-0597P	Peptides: DPPA2 (developmental pluripotency associated gene2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
K-CF0031	MAIN FILTERS for Circulaire W700, type: ACID, Purpose: Mineral Acids		313-Eur	Monmouth Scientific
bs-0603P	Peptides: OAT4L, URAT1 (Urate Transporter 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
K-CF0177	MAIN FILTERS for Circulaire W1000, type: ACID, Purpose: Mineral Acids		313-Eur	Monmouth Scientific
K-CF0007	Main Filters for CT800/CT1400, Type: ACID, Purpose: Mineral Acids		349-Eur	Monmouth Scientific
K-CF0007	Main Filters for Circulaire 1400EX, Type:ACID, Purpose: Mineral Acids		349-Eur	Monmouth Scientific
K-CF0121	Main Filters for Circulaire 900 cabinet, type: ACID, purpose: Mineral Acids		384-Eur	Monmouth Scientific
bs-0606P	Peptides: OAT-1 (Organic anion transporter 1)human Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0607P	Peptides: OAT-1 (Organic anion transporter 1)mouse、rat Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
K-CF0055	Outlet Filters for Circulaire 1100EX, Type:ACID, Purpose: Mineral Acids		159-Eur	Monmouth Scientific
K-CF0067	Outlet Filters for CT800 CT1400, Type: ACID, Purpose: Mineral Acids		172-Eur	Monmouth Scientific
K-CF0007	Main Filters for CT800 CT1400, Type: ACID, Purpose: Mineral Acids		349-Eur	Monmouth Scientific
bs-0259P	Peptides: SM-MHC(Cardiac myosin heavy chain) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2048P	Peptides: HER2 receptor(erbB-2 isoform 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0996P	Peptides: ERK(Extracellular signal-regulated kinase) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2003P	Peptides: H1N1(Influenza A virus ,hemagglutinin) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2002P	Peptides: H1N1(Influenza A virus ,hemagglutinin) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1000P	Peptides: CNP_CNPase ( 2',3'-cyclic-nucleotide 3'-phosphodiesterase) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2001P	Peptides: H1N1(Influenza A virus ,hemagglutinin) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1004P	Peptides: ACE2(Angiotensin converting enzyme 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1992P	Peptides: mTOR(Mammalian target of rapamycin) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0786P	Peptides: HIV-1(human immunodeficiency virus type 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2004P	Peptides: H1N1(Influenza A virus ,hemagglutinin) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0982P	Peptides: phospho-NFKB p65 (pSer536) peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
HSP0603	Heat shock proteins (Chaperonins): HSP70 (amino acids 1-641) Human, His tag, E.coli	0.5mg	478-Eur	ATGen	Proteins
CSB-E08770r	Rat free fatty acids,FFA ELISA Kit, Species Rat, Sample Type serum, plasma	96T	981-Eur	Cusabio	elisa
CSB-E13180p	Pig free fatty acids,FFA ELISA Kit, Species Pig, Sample Type serum, plasma	96T	981-Eur	Cusabio	elisa
HSP0501	Heat shock proteins (Chaperonins): HSP90 (amino acids 1-732), Human, His-tag, E.coli	100ug	340-Eur	ATGen	Proteins
bs-2034P	Peptides: SMN1(survival of motor neuron 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2030P	Peptides: NR1_NMDAR1_GLUR1(N-Methyl-d-Asprtate receptor 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2019P	Peptides: phospho-KLF5_Krueppel-like factor 5 (pSer272) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2012P	Peptides: NIT2 (nitrilase family, member 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0811P	Peptides: cx3cl1(chemokine (C-X3-C motif) ligand 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1959P	Peptides: CD122_IL-2RB(Imterleukm-2 Receptor beta) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1158P	Proteins: AGEs (advanced glycosylation end products) Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-0566P	Peptides: Smad7(Mothers against decapentaplegic homolog 7) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
PM-111	Nucleic acids: A1715 AP reverse primer(for integration diagnostics of all AP" expression vectors with 5'utr aprt)"	2,5nmol	56-Eur	Jena Bio
PM-110	Nucleic acids: P1442 Insert sequencing forward primer(for all AP" expression vectors with 5'utr aprt)"	2,5nmol	56-Eur	Jena Bio
CSB-EL007623RA	Rat Elongation of very long chain fatty acids protein 5(ELOVL5) ELISA kit SpeciesRat	96T	816-Eur	Cusabio	Elisa kits
bs-0769P	Peptides: PARP(poly ADP-ribose polymerase) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0538P	Peptides: Cdkn1c_p57_Kip2 (Cyclindependent kinase inhibitor 1C) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CSB-EL007624RA	Rat Elongation of very long chain fatty acids protein 6(ELOVL6) ELISA kit SpeciesRat	96T	816-Eur	Cusabio	Elisa kits
PM-106	Nucleic acids: A1045 F4 reverse primer(for integration diagnostics of all F4" expression vectors with 5'utr camBA)"	2,5nmol	56-Eur	Jena Bio
bs-2049P	Proteins: rhEGF(rh-Epidermal growth factor) Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
PM-116	Nucleic acids: H4132 Insert sequencing forward primer(for pLEXSY_invitro-1 expression vector)	2,5nmol	56-Eur	Jena Bio
bs-0461P	Peptides: CYP450(Cytochrome P450 monooxygenase) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0542P	Peptides: CDK1 (Cyclin-Dependent Kinase 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1958P	Peptides: NTCP(Na+_taurocholate Cotransporting Polypeptide) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
Y-0113	Peptides: A Beta1-40 (mutation type, MT) peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0785P	Peptides: HIV-1(human immunodeficiency virus type 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1043P	Peptides: MDM2 (urine double minute 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1044P	Peptides: MIF (Macrophage Migration Inhibitory Factor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
HSP0501	Heat shock proteins (Chaperonins): HSP90 (amino acids 1-732), Human, His-tag, E.coli	0.5mg	820-Eur	ATGen	Proteins
bs-1860P	Peptides: CRLR_CALCRL(calcitonin receptor like precursor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2227P	Proteins: GDF8_MSTN(growth differntiation factor 8) Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
HSP06032	HSP70 (amino acids 1_641) Human, Recombinant, His_ tagged, E.coli	0.2 mg	475-Eur	Assaypro	recombinant
bs-2216P	Peptides: IL-1RA (Interleukin-1 receptor antagonist)peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
1242	LACTALBUMIN HYDROLYSATE (BACTERIOLOGICAL GRADE) (rich in all essential amino acids and suitable for v	500 gm	154-Eur	TitanBiotech
bs-0876P	Peptides: phospho-AKT1_PKB1_2_3(pThr473)peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2224P	Peptides: phospho-Smad2(p-Ser465)petide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0444P	Peptides: slc22A17 (solute carrier famili 22) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2240P	Peptides: MLC_Myosin light chain 3 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2132P	Peptides: Agtr1_AT1a(Angiotensin II receptor, type 1a) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2130P	Peptides: Ki-67(Antigen identified by monoclonal antibody Ki 67) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2157P	Peptides: Polycystin 1(Polycystic Kidney Disease 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0556P	Peptides: HMGA2 (high mobility group A2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2158P	Peptides: Polycystin 2(polycystic kidney disease 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0894P	Peptides: ER- Alpha(phospho-Ser167)peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
HSP06035	HSP70 (amino acids 1_641) Human, Recombinant, His_ tagged, E.coli	1 mg	1540-Eur	Assaypro	recombinant
bs-2171P	Peptides: URGCP_URG4(Up-regulator of cell proliferation) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2169P	Peptides: VWCE_URG11(von Willebrand factor C and EGF domain-containing) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2197P	Peptides: DHAV(duck hepatitis A virus) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2199P	Peptides: beta-Amyloid(1-16) peptide (rat, mouse) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2210P	Peptides: phospho-p38 ERK_MAPK14 (pThr180_pTyr182) peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2215P	Peptides: PCNA(phosphos Dyr211)peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0446P	Peptides: TTF-2(thyroid transcription factor 2;forkhead box E1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2127P	Peptides: 5-HTR4(5 hydroxytryptamine serotonin receptor 4) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0559P	Peptides: CDK5(Cyclin Dependent Kinase 5) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2431P	Peptides: BAFF_CD257(B cell activating factor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0441P	Peptides: ChRM2 (Muscarinic Acetylcholine receptor M2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
LIP	Lipolysis Assay KIT Dual glycerol and free fatty acids Detection (REAGENTS + CELLS)	kit	1344-Eur	ZenBio	elisa
bs-0439P	Peptides: ACE( ACE, testis-specific isoform precursor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0848P	Peptides: Anti-CSP (circumsporozoite protein_Plasmodium yoelii) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
HSP0603	Heat shock proteins (Chaperonins): HSP70 (amino acids 1-641) Human, His tag, E.coli	100ug	226-Eur	ATGen	Proteins
bs-0840P	Peptides: AMACR_P504S(alpha-methylacyl-CoA racemase) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0859P	Peptides: HHV8_ORF50(Human herpesvirus 8 type P) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2097P	Peptides: AT1R_AGTR1(Angiotensin II Type 1 Receptor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0860P	Peptides: HHV8_ORF50(Human herpesvirus 8 type P) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2126P	Peptides: 5-HTR3(5-hydroxytryptamine (serotonin) receptor 3a) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0923P	Peptides: Pdx1(pancreatic and duodenal homeobox 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2110P	Peptides: VSV-G tag(vesicular stomatitis virus glycoprotein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0870P	Peptides: HHV8_ORF K2(Human herpesvirus 8 type P) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0869P	Peptides: HHV8_ORF K2_vIL-6(Human herpesvirus 8) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2250P	Peptides: Integrin alpha V_CD51 peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2270P	Peptides: Phospho-PAK4 (Ser99) peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0937P	Peptides: NPY2R(Neuropeptide Y Receptor Type 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0836P	Peptides: MLH1(Mutl homolog l gene) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0415P	Peptides: TIMP-1(Tissue Inhibitor of Metalloproteinase-1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0714P	Peptides: E7 protein_HPV 16 (Human papillomavirus type 16) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0711P	Peptides: FAM3B_PANDER(PANcreatic DERived factor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1657P	Peptides: phospho-STAT1(p-Tyr701) peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0416P	Peptides: TIMP-2(Tissue Inhibitor of Metalloproteinase-2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1643P	Peptides: ER- Alpha(phospho-Tyr537)peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1640P	Peptides: phospho-JNK1_2_3(pThr183_pTyr185) peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0705P	Peptides: LDL-R(Low-density lipoprotein receptor precursor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1150P	Peptides: ChRM1(muscarinic acetylcholine receptor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0718P	Peptides: Smad2(Mothers against decapentaplegic homolog 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0570P	Peptides: CDK8(Cyclin Dependent Kinase 8) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2050P	Proteins: rh-EGF(Recombinant Epidermal growth factor) Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-1103P	Peptides: B7-H1_PDL1_CD274(programmed death ligand 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0735P	Peptides: FGF-8_HBGF-8 (Fibroblast growth factor 8) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
HSP06035	HSP70 (amino acids 1_641) Human, Recombinant, His_ tagged, E.coli	1 mg	1403-Eur	Assaypro	recombinant
SMC-184C	HIF1 alpha, ESEE122 Monoclonals AntibodiesESEE122 Recombinant fragment corresponding to amino acids 329-530	25ug	152-Eur	Stressmarq
SMC-184D	HIF1 alpha, ESEE122 Monoclonals AntibodiesESEE122 Recombinant fragment corresponding to amino acids 329-530	100ug	296-Eur	Stressmarq
bs-1128P	Peptides: SGLT1(sodium-glucose cotransporter1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0418P	Peptides: TIMP-4(Tissue Inhibitor of Metalloproteinase-4) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0417P	Peptides: TIMP-3(Tissue Inhibitor of Metalloproteinase-3) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1153P	Peptides: Bid (BH3 interacting domain death agonist) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1634P	Peptides: ATF6(activating transcription factor 6) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0577P	Peptides: CD25_IL-2RA(Imterleukm-2 Receptor alpha) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0384P	Peptides: GLUT4(Glucose transporter type 4) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
SMC-349D	Kv1.5 K+ channel, S7-45 Monoclonals AntibodiesS7-45 Fusion protein amino acids 542-602 (Cytoplasmic C-terminus) of rat Kv1.5	100ug	324-Eur	Stressmarq
bs-0532P	Peptides: PHD3 (Egln3; HIF-prolyl hydroxylase 3) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1536P	Peptides: FSH(Follicle-stimulating hormone precursor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
SMC-352D	Kv1.2 K+ channel, S14-16 Monoclonals AntibodiesS14-16 Fusion protein amino acids 428-499 (cytoplasmic C-terminus) of rat Kv1.2	100ug	324-Eur	Stressmarq
SMC-355D	Kv1.1, S20-78 Monoclonals AntibodiesS20-78 Synthetic peptide amino acids 458-476 (cytoplasmic C-terminus) of rat Kv1.1 (EEDMNNSIAHYRQANIRTG)	100ug	324-Eur	Stressmarq
SMC-357D	Pan-MAGUK, S28-86 Monoclonals AntibodiesS28-86 Fusion protein Amino acids 77-299 of human PSD95_Sap90	100ug	324-Eur	Stressmarq
SMC-335D	KV3.4, S72-16 Monoclonals AntibodiesS72-16 Synthetic peptide amino acids 175-192 of rat Kv3,4, accession number Q63734	100ug	324-Eur	Stressmarq
bs-1161P	Peptides: GRM2_GLUR2 (Glutamate Receptor Metabotropic 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1608P	Peptides: PDCD4(programmed cell death 4) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0699P	Peptides: SLC33A1(Acetyl-coenzyme A transportor 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1705P	Peptides: AVPR2(arginine vasopressin receptor 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0679P	Peptides: SYVN1(synovial apoptosis inhibitor 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1155P	Peptides: ASCL1_MASH1(Achaete-scute homolog 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1628P	Peptides: CXCR6(CXC-chemokine receptor 6) peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1627P	Peptides: ABCA1(ATP binding cassette transporter A1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0472P	Peptides: GLUT1(Glucose transporter type 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0739P	Peptides: PAP2c (Phosphatidic acid phosphatase 2c) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
SMC-359D	Kv2.2, S37-89 Monoclonals AntibodiesS37-89 Fusion protein amino acids 1-61 of rat kv2.2, accession number Q63099.	100ug	324-Eur	Stressmarq
bs-0746P	Peptides: HHV8_ORF50(Human herpesvirus 8 type P) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1606S	Nucleic acids: 3TCTP, S pack Lamivudine triphosphate, Sodium Salt (L-Isomer)	5Units	128-Eur	Jena Bio
HSP0603	HSP70 (amino acids 1_641) Human, Recombinant, His_ tagged, E.coli	1mg	761-Eur	ATGen	recombinant
bs-0568P	Peptides: CDK6 (Cyclin Dependent Kinase 6) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
1242	LACTALBUMIN HYDROLYSATE (BACTERIOLOGICAL GRADE) (rich in all essential amino acids and suitable for v	500 gm	154-Eur	TitanBiotech
bs-1745P	Peptides: HCFHrp_BTA(Bladdertumor antigen)human Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1066P	Peptides: Nm23-H1 (nucleoside dIPhosphatase kinase A) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1753P	Peptides: ECE2(Endothelin Converting Enzyme 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1065P	Peptides: NGX6 (nasopharyngeal carcinoma_NPC associated gene 6) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1067P	Peptides: NR2C_NMDAR2C(N-Methyl-d-Asprtate receptor 2C) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1068P	Peptides: NR1_NMDAR1(N-Methyl-d-Asprtate receptor 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
ARP49667_P050	ELOVL5(ELOVL family member 5, elongation of long chain fatty acids)	50 µg	513-Eur	ACR
bs-0742P	Peptides: p27 (cyclin-dependent kinase inhibitor 1B) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
HSP0603	HSP70 (amino acids 1_641) Human, Recombinant, His_ tagged, E.coli	100ug	202-Eur	ATGen	recombinant
NU-1606L	Nucleic acids: 3TCTP, L pack Lamivudine triphosphate, Sodium Salt (L-Isomer)	25Units	316-Eur	Jena Bio
NU-1605S	Nucleic acids: 3TCMP, S pack Lamivudine monophosphate, Sodium Salt (L-Isomer)	10Units	128-Eur	Jena Bio
bs-1084P	Peptides: PEG10(Paternally expressed gene 10) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1728P	Peptides: CX3CR1(CX3C-chemokine receptor 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1707L	Nucleic acids: N6-(6-Azido)hexyl-3'-dATP, L pack (Cordycepin triphosphate derivative)	100Units	316-Eur	Jena Bio
bs-1098P	Peptides: PLAU_uPA (Plasminogen activator,urokinase) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1707S	Nucleic acids: N6-(6-Azido)hexyl-3'-dATP, S pack (Cordycepin triphosphate derivative)	20Units	128-Eur	Jena Bio
bs-0757P	Peptides: CDK2 (Cyclin-Dependent Kinase 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
PM-102	Nucleic acids: A992 insert sequencing forward primer(for all F4" expression vectors with 5'utr camBA)"	2,5nmol	56-Eur	Jena Bio
CCP01-1LT	Media,Cereal Crops Medium with macro- and micronutrients, amino acids, and carbohydrates.	1L	56-Eur	Caisson Laboratory
CCP01-5LT	Media,Cereal Crops Medium with macro- and micronutrients, amino acids, and carbohydrates.	5L	59-Eur	Caisson Laboratory
NU-1605L	Nucleic acids: 3TCMP, L pack Lamivudine monophosphate, Sodium Salt (L-Isomer)	50Units	316-Eur	Jena Bio
bs-1092P	Peptides: MRP2 (multidrug resistance-associated protein2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0003P	Peptides: TSHR (Thyroid stimulating hormone receptor)(NT) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0496P	Peptides: SLC24A5 (solute carrier family 24, member 5) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1513P	Peptides: EpCAM_CD326(Epithelial cell adhesion molecule) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2172P	Peptides: URGCP_URG4(Up-regulator of cell proliferation)C terminal Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1400P	Peptides: MEF2(myocyte enhancer-binding factor 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CSB-EL021717MO	Mouse Large neutral amino acids transporter small subunit 1(SLC7A5) ELISA kit	96T	626-Eur	Cusabio	Elisa kits
bs-1586P	Peptides: VEGF-C(Vascuoar endothelial growth factor-C) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0054P	Peptides: TmR2(GDNFR Beta；TRN-R；GFR-alpha-2；NTNR-2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0884P	Proteins: rh-IL-1Ra(Recombinant Human Interleukin-1 receptor antagonist His Tag) Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-2138P	Peptides: PARP(poly ADP-ribose polymerase)N-Terminus Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0352P	Peptides: DLX4 (Dsital-less homebox4 isoformAlpha_ Beta) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0162P	Peptides: NOS-2 (iNOS) Nitric Oxide Synthase,Inducible Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CSB-EL021717HU	Human Large neutral amino acids transporter small subunit 1(SLC7A5) ELISA kit	96T	626-Eur	Cusabio	Elisa kits
bs-0229P	Peptides: FGF1 (aFGF )(ECGF-beta)(HBGF-1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1585P	Peptides: CLCA4(Calcium-activated chloride channel 4) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CSB-EL021646BO	Bovine Large neutral amino acids transporter small subunit 4(SLC43A2) ELISA kit	96T	710-Eur	Cusabio	Elisa kits
CSB-EL021721HU	Human Large neutral amino acids transporter small subunit 2(SLC7A8) ELISA kit	96T	626-Eur	Cusabio	Elisa kits
bs-0339P	Peptides: ECG2 (sophagus cancer-related gene-2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0460P	Peptides: TSHR (Thyroid stimulating hormone receptor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2469P	Peptides: PERK(PRKR-like endoplasmic reticulum kinase) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0426P	Peptides: MOG35-55 (myelin oligo-dendrocyte glycoprotein-MOG) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0206P	Peptides: TSHR (Thyroid stimulating hormone receptor)(CT) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
HSP0502	Heat shock proteins (Chaperonins): Hsp104 (amino acids 1-908) Saccharomyces cerevisiae, E.coli	100ug	226-Eur	ATGen	Proteins
bs-0435P	Peptides: PAR-2 AP (Protease-activated receptors-2 Activating polypeptide) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2018P	Peptides: S6PDH(NADP sorbitol-6-phosphate dehydrogenase) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0203P	Peptides: ACEI (Angiotensin I Converting Enzyme Inhibitor ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0058P	Peptides: Apaf-1 (Apoptosis protease activating factor-1)(CT) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0284P	Peptides: IASPP(inhibitory member of the ASPP family) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0201P	Peptides: GFRAlpha-1(GDNF family receptor alpha-1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0279P	Peptides: VEGF(Vascular endothelial growth factor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CSB-EL021646HU	Human Large neutral amino acids transporter small subunit 4(SLC43A2) ELISA kit	96T	626-Eur	Cusabio	Elisa kits
bs-4002P	Peptides: phospho-AMPK alpha 1(Thr172) peptaide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1957P	Peptides: VEGF-A(Vascuoar endothelial growth factor A) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0449P	Peptides: TSLP(Thymic stromal lymphopoietin isoform 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0248P	Peptides: BDNF (Brain-derived Neurotrophin factor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0059P	Peptides: Apaf-1 (Apoptosis protease activating factor-1)(NT) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1407P	Peptides: HIF-1 Beta_ARNT1(Hypoxia-inducible factor-1 Beta) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0214P	Peptides: ICAD(Inhibitor of Caspase-Activated DNase ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2101P	Peptides: TEM 1_CD248(Tumor endothelial marker 1 precursor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1499P	Peptides: SUMO(small ubiquitin-related modifier) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0420P	Peptides: PIBF(progesterone induced blocking factor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0334P	Peptides: MTLC (c-Myc target from laryngeal cancer cells)又称：MYC Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CSB-EL021646MO	Mouse Large neutral amino acids transporter small subunit 4(SLC43A2) ELISA kit	96T	626-Eur	Cusabio	Elisa kits
CSB-EL021645MO	Mouse Large neutral amino acids transporter small subunit 3(SLC43A1) ELISA kit	96T	626-Eur	Cusabio	Elisa kits
CSB-EL021721MO	Mouse Large neutral amino acids transporter small subunit 2(SLC7A8) ELISA kit	96T	626-Eur	Cusabio	Elisa kits
HSP0502	Heat shock proteins (Chaperonins): Hsp104 (amino acids 1-908) Saccharomyces cerevisiae, E.coli	0.5mg	478-Eur	ATGen	Proteins
bs-2087P	Peptides: TSHR (Thyroid stimulating hormone receptor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
Y-0114	Peptides: A Beta1-40 (H-3-me6;H-3-me13;H-3-me14; Beta-Amyloid 1-40) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CSB-EL021645HU	Human Large neutral amino acids transporter small subunit 3(SLC43A1) ELISA kit	96T	626-Eur	Cusabio	Elisa kits
CSB-EL007622MO	Mouse Elongation of very long chain fatty acids protein 4(ELOVL4) ELISA kit SpeciesMouse	96T	816-Eur	Cusabio	Elisa kits
CSB-EL021717RA	Rat Large neutral amino acids transporter small subunit 1(SLC7A5) ELISA kit SpeciesRat	96T	816-Eur	Cusabio	Elisa kits
CSB-EL021721RA	Rat Large neutral amino acids transporter small subunit 2(SLC7A8) ELISA kit SpeciesRat	96T	816-Eur	Cusabio	Elisa kits
CCP01-10LT	Media,Cereal Crops Medium with macro- and micronutrients, amino acids, and carbohydrates.	10L	63-Eur	Caisson Laboratory
EGE-245	Nucleic acids: pLEXSY_I-neo3 integrative inducible expression vectorantibiotic selection of transfectants with LEXSY Neo	5	467-Eur	Jena Bio
bs-0938P	Peptides: NKG2D(natural killer cell group 2D) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0943P	Peptides: phospho-AR_androgen receptor( p-Ser580)peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
EGE-234	Nucleic acids: pLEXSY-sat2 integrative constitutive expression vectorantibiotic selection of transfectants with LEXSY NTC	5	467-Eur	Jena Bio
bs-1151P	Peptides: TRBF1 (Telomeric repeat binding factor 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
N-10502-1G	Nucleic acids: 2'-Fluoro-2'-deoxy-arabinofuranosyl-2_6-diamino-purine-riboside, 1 g pack 2'-FANA-DAP	1g	1035-Eur	Jena Bio
bs-0768P	Peptides: IL-16_LCF(interleukin-16)(Lymphocyte Chemotactic Factor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1077P	Peptides: OCT2 (Octamer-binding transcription factor 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
N-10502-500	Nucleic acids: 2'-Fluoro-2'-deoxy-arabinofuranosyl-2_6-diamino-purine-riboside, 500 mg pack 2'-FANA-DAP	500mg	580-Eur	Jena Bio
CSB-EL007623MO	Mouse Elongation of very long chain fatty acids protein 5(ELOVL5) ELISA kit SpeciesMouse	96T	816-Eur	Cusabio	Elisa kits
N-10502-250	Nucleic acids: 2'-Fluoro-2'-deoxy-arabinofuranosyl-2_6-diamino-purine-riboside, 250 mg pack 2'-FANA-DAP	250mg	333-Eur	Jena Bio
CSB-EL007624MO	Mouse Elongation of very long chain fatty acids protein 6(ELOVL6) ELISA kit SpeciesMouse	96T	816-Eur	Cusabio	Elisa kits
CSB-EL007623BO	Bovine Elongation of very long chain fatty acids protein 5(ELOVL5) ELISA kit SpeciesBovine	96T	913-Eur	Cusabio	Elisa kits
CSB-EL007625MO	Mouse Elongation of very long chain fatty acids protein 7(ELOVL7) ELISA kit SpeciesMouse	96T	816-Eur	Cusabio	Elisa kits
bs-1141P	Peptides: STAT3(signal transducers and activators of transduction3) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1134P	Peptides: CBFA1_RUNX2 (Runt-related Transcription Factor 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
EGE-233	Nucleic acids: pLEXSY-neo2 integrative constitutive expression vectorantibiotic selection of transfectants with LEXSY Neo	5	467-Eur	Jena Bio
bs-0743P	Peptides: CTGF (connective tissue growth factor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0740P	Peptides: P16_CDKN2A (Cyclin-dependent kinase inhibitor-2A) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
SMC-365D	Pan-KCHIP, S55-82 Monoclonals AntibodiesS55-82 Fusion protein amino acids 1-216 (full length) of rat KChIP1b	100ug	324-Eur	Stressmarq
bs-0999P	Peptides: GM-CSF(Granulocyte-Macrophage Colony Stimulating Factors) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1220P	Peptides: TSARG4(Testis and spermatogenesis related gene 4) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
SMC-361D	Pan-KvBeta, S40-17 Monoclonals AntibodiesS40-17 Fusion protein amino acids 1-401 (full length) of rat Kvβ1	100ug	324-Eur	Stressmarq
orb82678	Human CXCL13 protein Single, non-glycosylated polypeptide chain containing 87 amino acids. For research use only.	1 mg	2079-Eur	Biorb	human
bs-0686P	Peptides: PTEN_MMAC1(CT)human, mo, rat, pig, dog, bovine, horse, chicken Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0684P	Peptides: CD147_EMMPRIN(Extracellular matrix metalloproteinase inducer) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1049P	Peptides: CHRNA7(Nicotinic-Acetylcholine receptor alpha 7) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
SMC-367D	Kv4.2 K+ channel, S57-1 Monoclonals AntibodiesS57-1 Synthetic peptide amino acids 209-225 (extracellular S1-S2 loop) of rat Kv4.2 (CGSSPGHIKELPSGERY	100ug	324-Eur	Stressmarq
29-951	SLC43A2 is a Sodium-, chloride, pH-independent high affinity transport of large neutral amino acids.	0.05 mg	632-Eur	Prosci
bs-0546P	Peptides: TSGF(Tumor Specific Growth Fanctor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0736P	Peptides: CD56_NCAM1 (Neural Cell Adhesion Molecule 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0734P	Peptides: FGF-7_KGF (Keratinocyte growth factor precursor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1258P	Peptides: ICAM-2_CD102(intercellular adhesion molecules-2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0540P	Peptides: HAI-1(Hepatocyte Growth Factor Activator Inhibitor 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1251P	Peptides: CD166_ALCAM(activated leukocyte celladhesion molecule) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1249P	Peptides: EpCAM(Epithelial cell adhesion molecule) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1244P	Peptides: CK1_8_19 (Cytokeratin1_8_19; Keratin 1_8_19)peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0548P	Peptides: C-Mer_MERTK (proto-oncogene tyrosine kinase) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0675P	Peptides: FGFR2(Fibroblast Growth Factor Receptor 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0783P	Peptides: SDF-1_CXCL12 (stromal cell derived factor-1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1210P	Peptides: BRCA2(Breast cancer susceptbility gene 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0792P	Peptides: Maspin (mammary serine protease inhibitor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CSB-EL007620HU	Human Elongation of very long chain fatty acids protein 2(ELOVL2) ELISA kit SpeciesHuman	96T	816-Eur	Cusabio	Elisa kits
CSB-EL007625BO	Bovine Elongation of very long chain fatty acids protein 7(ELOVL7) ELISA kit SpeciesBovine	96T	913-Eur	Cusabio	Elisa kits
28-059	ZFPL1 is expressed strongly in the exocrine pancreas as a 1.4-kb polyadenylated RNA encoding a putative protein of 310 amino acids.	0.05 mg	632-Eur	Prosci	rna
ELOVL3	ELOVL1 Gene elongation of very long chain fatty acids (FEN1_Elo2, SUR4_Elo3, yeast)-like 1		----Eur	Transposagen
CSB-EL007624CH	Chicken Elongation of very long chain fatty acids protein 6(ELOVL6) ELISA kit SpeciesChicken	96T	913-Eur	Cusabio	Elisa kits
CSB-EL007619HU	Human Elongation of very long chain fatty acids protein 1(ELOVL1) ELISA kit SpeciesHuman	96T	816-Eur	Cusabio	Elisa kits
CSB-EL007621HU	Human Elongation of very long chain fatty acids protein 3(ELOVL3) ELISA kit SpeciesHuman	96T	816-Eur	Cusabio	Elisa kits
bs-0595P	Peptides: DMBT1 (Deleted in malignant brain tumor 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1333P	Peptides: TFAR19(TF-1 cell apoptsis-related gene 19) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0793P	Peptides: CSIG(cellular senescence inhibited gene) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
ELOVL4	ELOVL2 Gene elongation of very long chain fatty acids (FEN1_Elo2, SUR4_Elo3, yeast)-like 2		----Eur	Transposagen
bs-1361P	Peptides: GADD153(Growth arrest and DNA damage-inducible 153) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0856P	Peptides: SLC34A2_NaPi-2b(Solute carrier family 34 member 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
27-136	ZFPL1 is expressed strongly in the exocrine pancreas as a 1.4-kb polyadenylated RNA encoding a putative protein of 310 amino acids.	0.05 mg	632-Eur	Prosci	rna
SEJ169Ra	ELISA Kit for Elongation Of Very Long Chain Fatty Acids Like Protein 1 (ELOVL1) Rattus norvegicus (Rat)	96T	738-Eur	USCNLife	Elisa kits
bs-0832P	Peptides: MICA(MHC class I polypeptide-related sequence A) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0820P	Peptides: EBNA-3 (Epstein barr nuclear antigens 3) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0805P	Peptides: CD56_NCAM1(Neural Cell Adhesion Molecule 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
N-PYA11001-10	Nucleic acids: Formycin A monohydrate, 10 mg pack 7-Amino-3-beta-D-ribofuranosyl-1H-pyrazolo[4,3-d]pyrimidine	10mg	471-Eur	Jena Bio
ELOVL6	ELOVL4 Gene elongation of very long chain fatty acids (FEN1_Elo2, SUR4_Elo3, yeast)-like 4		----Eur	Transposagen
ELOVL5	ELOVL3 Gene elongation of very long chain fatty acids (FEN1_Elo2, SUR4_Elo3, yeast)-like 3		----Eur	Transposagen
CSB-EL007622HU	Human Elongation of very long chain fatty acids protein 4(ELOVL4) ELISA kit SpeciesHuman	96T	816-Eur	Cusabio	Elisa kits
bs-0500P	Peptides: ECG2 (sophagus cancer-related gene-2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0900P	Peptides: MGr1-Ag_37LRP(P37-kDa laminin receptor precursor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1143P	Peptides: STAT6(signal transducers and activators of transduction 6) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1142P	Peptides: STAT5(signal transducers and activators of transduction5) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CSB-EL007622RH	Monkey Elongation of very long chain fatty acids protein 4(ELOVL4) ELISA kit SpeciesMonkey	96T	913-Eur	Cusabio	Elisa kits
bs-0895P	Peptides: FSH-R(Follicle-stimulating hormone receptor precursor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0731P	Peptides: PEDF (pigment epithelium-derived factor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1317P	Peptides: STAT1(signal transducers and activators of transcription 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0901P	Peptides: MGr1-Ag_37LRP(P37-kDa laminin receptor precursor)(CT) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CSB-EL007619MO	Mouse Elongation of very long chain fatty acids protein 1(ELOVL1) ELISA kit SpeciesMouse	96T	816-Eur	Cusabio	Elisa kits
bs-1147P	Peptides: TSLC1 (tumor suppressor in lung cancer-1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CSB-EL007620MO	Mouse Elongation of very long chain fatty acids protein 2(ELOVL2) ELISA kit SpeciesMouse	96T	816-Eur	Cusabio	Elisa kits
CSB-EL007625HU	Human Elongation of very long chain fatty acids protein 7(ELOVL7) ELISA kit SpeciesHuman	96T	816-Eur	Cusabio	Elisa kits
CSB-EL007621MO	Mouse Elongation of very long chain fatty acids protein 3(ELOVL3) ELISA kit SpeciesMouse	96T	816-Eur	Cusabio	Elisa kits
CSB-EL007624HU	Human Elongation of very long chain fatty acids protein 6(ELOVL6) ELISA kit SpeciesHuman	96T	816-Eur	Cusabio	Elisa kits
CSB-EL007623HU	Human Elongation of very long chain fatty acids protein 5(ELOVL5) ELISA kit SpeciesHuman	96T	816-Eur	Cusabio	Elisa kits
bs-0891P	Peptides: Pokemon (POK Erythroid Myeloid Ontogenic factor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1144P	Peptides: TFPI-2 (tissue factor pathway inhibitor-2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0281P	Peptides: PLGF (Placenta growth factor fragment)(human) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
SMC-364D	KChlP1 K+ channel, S55-7 Monoclonals AntibodiesS55-7 Fusion protein amino acids 1-216 (Full lenght) of rat KChIPIb	100ug	324-Eur	Stressmarq
bs-1702P	Peptides: Fut4_CD15_SSEA-1(Stage-specific embryonic surface antigen 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1085P	Peptides: C-erbB-4_HER4_erbB-4 (epidermal growth factor receptor4) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
SPC-164D	BIM_BOD (IN2) Antibody Polyclonal Host: Rabbit Immunogen: Internal central amino acids of human Bim	100ug	279-Eur	Stressmarq
SPC-164C	BIM_BOD (IN2) Antibody Polyclonal Host: Rabbit Immunogen: Internal central amino acids of human Bim	25ug	143-Eur	Stressmarq
SMC-368D	KChlP2 K+ channel, S60-73 Monoclonals AntibodiesS60-73 Fusion protein amino acids 1-252 (Full lenght) of rat KChIP2b	100ug	324-Eur	Stressmarq
SMC-371D	KChlP3 K+ channel, S66-38 Monoclonals AntibodiesS66-38 Fusion protein amino acids 1-256 (Full lenght) of rat Calsenillin_DREAM_KChIP3	100ug	324-Eur	Stressmarq
SPC-113D	BIM_BOD (IN) Antibody Polyclonal Host: Rabbit Immunogen: Internal central amino acids of human Bim	100ug	248-Eur	Stressmarq
SPC-113C	BIM_BOD (IN) Antibody Polyclonal Host: Rabbit Immunogen: Internal central amino acids of human Bim	25ug	120-Eur	Stressmarq
SMC-353D	KvBeta2 K+ channel, S17-70 Monoclonals AntibodiesS17-70 Fusion protein amino acids 1-367 (full length) of rat Kvβ2	100ug	324-Eur	Stressmarq
PM-117	Nucleic acids: H4134 Forward primer for overlap extension PCR(for LEXSY cell-free protein expression kit)	0,5nmol	56-Eur	Jena Bio
bs-1838P	Peptides: TIEG1_KLF10(TGF-beta inducible early response gene 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CSB-EL021717MO	Mouse Large neutral amino acids transporter small subunit 1(SLC7A5) ELISA kit SpeciesMouse	96T	816-Eur	Cusabio	Elisa kits
CSB-EL021646HU	Human Large neutral amino acids transporter small subunit 4(SLC43A2) ELISA kit SpeciesHuman	96T	816-Eur	Cusabio	Elisa kits
CSB-EL021645HU	Human Large neutral amino acids transporter small subunit 3(SLC43A1) ELISA kit SpeciesHuman	96T	816-Eur	Cusabio	Elisa kits
bs-2168P	Peptides: DRADA_ADAR1(Double-stranded RNA-specific adenosine deaminase) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CSB-EL021721HU	Human Large neutral amino acids transporter small subunit 2(SLC7A8) ELISA kit SpeciesHuman	96T	816-Eur	Cusabio	Elisa kits
CSB-EL021717HU	Human Large neutral amino acids transporter small subunit 1(SLC7A5) ELISA kit SpeciesHuman	96T	816-Eur	Cusabio	Elisa kits
bs-2201P	Peptides: p-Arhgef2_GEF-H1(Rho guanine nucleotide exchange factor 2,pSer810) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CSB-EL021646BO	Bovine Large neutral amino acids transporter small subunit 4(SLC43A2) ELISA kit SpeciesBovine	96T	913-Eur	Cusabio	Elisa kits
bs-5551P	Peptides: phospho-AMPK alpha-1_PRKAA1(Thr198) peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0794P	Peptides: CD169_sialoadhesin(Sn)(Sialic acid-binding Ig-like lectin 1；Siglec-1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0803P	Peptides: BRCA1(Breast cancer susceptbility gene 1)(mouse rat) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0868P	Peptides: BKCa channels(calcium-activated potassium channel) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CSB-EL021721MO	Mouse Large neutral amino acids transporter small subunit 2(SLC7A8) ELISA kit SpeciesMouse	96T	816-Eur	Cusabio	Elisa kits
CSB-EL021645MO	Mouse Large neutral amino acids transporter small subunit 3(SLC43A1) ELISA kit SpeciesMouse	96T	816-Eur	Cusabio	Elisa kits
CSB-EL021646MO	Mouse Large neutral amino acids transporter small subunit 4(SLC43A2) ELISA kit SpeciesMouse	96T	816-Eur	Cusabio	Elisa kits
bs-1030P	Peptides: Anti-HMGA1 (high mobility group AT-hook 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0413P	Peptides: MMP-3(matrix metalloproteinase-3_Transin-1_SL-1_Stromelysin-1 precursor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
SMC-317D	Cavbeta1, S7-18 Monoclonals AntibodiesS7-18 Synthetic peptide amino acids 19-34 of rat CavB1, accession number NP_059042	100ug	324-Eur	Stressmarq
SMC-313D	KV3.1, S16B-8 Monoclonals AntibodiesS16B-8 Fusion protein amino acids 437-585 (C-terminus) or rat Kv3.1b, accession number NP_036988	100ug	324-Eur	Stressmarq
bs-1637P	Proteins: rh-VEGF(GST Tag)(Recombinant Vascuoar endothelial growth factor) Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-0459P	Peptides: GAPDH(Ribbt Anti-glyceraldehyde-3-phosphate Dehydrogease ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2074P	Peptides: CNGA2(Cyclic Nucleotide Gated Cation Alpha 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2202P	Peptides: VEGFR-3(Vascular Epidemal growth factor receptor-3) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0924P	Peptides: Mafa(avian)(V-maf musculoaponeurotic fibrosarcoma oncogene homolog A) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0920P	Peptides: VCAM-1_CD106 (Vascuolar cell adhesion molecule 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CSB-EL021721RB	Rabbit Large neutral amino acids transporter small subunit 2(SLC7A8) ELISA kit SpeciesRabbit	96T	913-Eur	Cusabio	Elisa kits
CSB-EL021717RB	Rabbit Large neutral amino acids transporter small subunit 1(SLC7A5) ELISA kit SpeciesRabbit	96T	913-Eur	Cusabio	Elisa kits
bs-0436P	Peptides: PAR-2 OP(Protease-activated receptors-2 Activating Orange-peptide) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0156P	Peptides: NOS-1(bNOS:neuronal NOS:nNOS:Nitric Oxide synthase-1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1451P	Peptides: PAFAH2_Lp-PLA2_PLA2G7(platelet-activating factor acetylhydrolase 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
ELOV5_MOUSE	ELISA Kit FOR Elongation of very long chain fatty acids protein 5; organism: Mouse; gene name: Elovl5	96T	876-Eur	EIAab	Elisa kits
bs-1454P	Peptides: ErbB-3_HER3(Epidermal growth factor receptor3) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
EGE-232	Nucleic acids: pLEXSY-hyg2 integrative constitutive expression vectorantibiotic selection of transfectants with LEXSY Hygro	5	467-Eur	Jena Bio
bs-0250P	Peptides: PPAR-delta (peroxisome proliferator-activated receptor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1268P	Peptides: MIP3 Alpha_CCL20(Macrophage inflammatory ptotein 3 alpha) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1300P	Peptides: Tie2(Porcine tyrosine kinase with immunoglobulin-like and EGF-like domains 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CSB-RP133474h	Recombinant human Large neutral amino acids transporter small subunit 3 Source: E.coli	1mg	1189-Eur	Cusabio
bs-1311P	Peptides: LYVE-1(lymphalic vessel endotheilial hyaluronan receptor 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
orb82822	CXCL12 protein Recombinant rat SDF-1alpha a single non-glycosylated polypeptide chain containing 68 amino acids. For research use only.	1 mg	2079-Eur	Biorb	recombinant
bs-0177P	Peptides: AGER(Advanced glycosylation end product-specific receptor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
SEJ169Hu	ELISA Kit for Elongation Of Very Long Chain Fatty Acids Like Protein 1 (ELOVL1) Homo sapiens (Human)	96T	688-Eur	USCNLife	Elisa kits
bs-0499P	Peptides: Neuroprotective peptide_Gly-HN(Nuclear-encoded Humanin [HN(N)] Gly14) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
EGE-244	Nucleic acids: pLEXSY_I-ble3 integrative inducible expression vectorantibiotic selection of transfectants with LEXSY Bleo	5	467-Eur	Jena Bio
ELOV2_MOUSE	ELISA Kit FOR Elongation of very long chain fatty acids protein 2; organism: Mouse; gene name: Elovl2	96T	876-Eur	EIAab	Elisa kits
ELOV3_MOUSE	ELISA Kit FOR Elongation of very long chain fatty acids protein 3; organism: Mouse; gene name: Elovl3	96T	876-Eur	EIAab	Elisa kits
ELOV7_MOUSE	ELISA Kit FOR Elongation of very long chain fatty acids protein 7; organism: Mouse; gene name: Elovl7	96T	876-Eur	EIAab	Elisa kits
ELOV4_MOUSE	ELISA Kit FOR Elongation of very long chain fatty acids protein 4; organism: Mouse; gene name: Elovl4	96T	876-Eur	EIAab	Elisa kits
ELOV6_MOUSE	ELISA Kit FOR Elongation of very long chain fatty acids protein 6; organism: Mouse; gene name: Elovl6	96T	876-Eur	EIAab	Elisa kits
orb80708	Human Endothelin 1 protein EDN1 contains 21 amino acids having a molecular mass of 2491.95 Dalton. For research use only.	1 mg	228-Eur	Biorb	human
ELOV1_MOUSE	ELISA Kit FOR Elongation of very long chain fatty acids protein 1; organism: Mouse; gene name: Elovl1	96T	876-Eur	EIAab	Elisa kits
orb80709	Human Endothelin 2 protein EDN2 contains 21 amino acids having a molecular mass of 2546.97 Dalton. For research use only.	1 mg	228-Eur	Biorb	human
bs-1277P	Peptides: CFTR(cystic fibrosis transmembrane conductance regulator) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
orb80710	Human Endothelin 3 protein EDN3 contains 21 amino acids having a molecular mass of 2634.1 Dalton. For research use only.	1 mg	228-Eur	Biorb	human
ELP3	ELOVL7 Gene ELOVL family member 7, elongation of long chain fatty acids (yeast)		----Eur	Transposagen
bs-1337P	Peptides: phospha-Bcl-xL (pSer62) peptide (human, mo, rat, bovine, dog, pig, sheep, horse) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
SMC-350D	KvBeta1.1 K+ channel, S9-40 Monoclonals AntibodiesS9-40 Synthetic peptide amino acids 7-28 (unique N-terminus) of rat Kvβ1.1 (TEHNLKSPNGEDRLLSKQSST)	100ug	324-Eur	Stressmarq
SMC-387D	Kv1.3, S23-27 Monoclonals AntibodiesS23-27 Synthetic peptide amino acids 485- 506 (Cytoplasmic Cterminus) of rat Kv1.3 (GGMNHSAFPQTPFKTGNSYATC), accession number P15384.	100ug	324-Eur	Stressmarq
SMC-327D	PAN-SHANK, S23b-49 Monoclonals AntibodiesS23b-49 Fusion protein amino acids 84-309 of rat Shank2; accession number Q9QX74	100ug	324-Eur	Stressmarq
bs-1024P	Peptides: GDNF (Glial cell line-derived neurotrphic factor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2020P	Peptides: phospho-Klf5_CKLF_Kruppel like factor 5, Human, mo, rat, horse, bovine, rabbit, pig, dog Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
LAT4_MOUSE	ELISA Kit FOR Large neutral amino acids transporter small subunit 4; organism: Mouse; gene name: Slc43a2	96T	876-Eur	EIAab	Elisa kits
bs-1324P	Peptides: CCL5_RANTES(regulated on activation normal T cell expressed and secreted) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1232P	Peptides: GABRA1(gamma-aminobutyric acid (GABA) A receptor, alpha 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
LAT3_MOUSE	ELISA Kit FOR Large neutral amino acids transporter small subunit 3; organism: Mouse; gene name: Slc43a1	96T	876-Eur	EIAab	Elisa kits
bs-0944P	Peptides: Shiga-like toxin IIe variant subunit A[Escherichia coli 0139] Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
BQ 092A-EALD	ENZYMATIC ASSAY KITS (CHEMISTRY AUTOANALYZER), LIVER DISEASES: Total Bile Acids (TBA) (Colorimetric) Kit	600 tests	471-Eur	Bioquant
LAT2_MOUSE	ELISA Kit FOR Large neutral amino acids transporter small subunit 2; organism: Mouse; gene name: Slc7a8	96T	876-Eur	EIAab	Elisa kits
LAT1_MOUSE	ELISA Kit FOR Large neutral amino acids transporter small subunit 1; organism: Mouse; gene name: Slc7a5	96T	876-Eur	EIAab	Elisa kits
bs-2167P	Peptides: DRADA_ADAR1(Double-stranded RNA-specific adenosine deaminase)N terminal Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
EGE-231	Nucleic acids: pLEXSY-ble2 integrative constitutive expression vector antibiotic selection of transfectants with LEXSY Bleo	5	467-Eur	Jena Bio
SMC-185C	HIF2 alpha, EP190b Monoclonals AntibodiesEP190B GST-human EPAS-1 (HIF2alpha) amino acids 535-631 fusion protein	25ug	152-Eur	Stressmarq
SMC-185D	HIF2 alpha, EP190b Monoclonals AntibodiesEP190B GST-human EPAS-1 (HIF2alpha) amino acids 535-631 fusion protein	100ug	296-Eur	Stressmarq
SMC-379D	Zinedin, S88-64 Monoclonals AntibodiesS88-64 Fusion protein amino acids 42- 354 of human Zinedin_Striatin- 4, accession number Q9NRL3	100ug	324-Eur	Stressmarq
SMC-380D	Kv2.1, S89-34 Monoclonals AntibodiesS89-34 Synthetic peptide amino acids 837-853 (cytoplamsic Cterminus) of rat KV2.1 (HMLPGGGAHGSTRDQSI), accession number NP_037318.	100ug	324-Eur	Stressmarq
bs-0583P	Peptides: ABL1(v-abl Abelson murine leukemia viral oncogene homolog 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1173P	Peptides: GITR (glucocorticoidinduced tumor necrosis factor receptor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0640P	Peptides: TIGAR humen (TP53- induced glycolysis and apoptosis-regulator ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
orb81694	HIV-1 p24 His Tag protein HIV-1 p24 His Tag Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 188 amino acids (155-321 a.a.) and having a molecular mass of 21.2	5	154-Eur	Biorb	recombinant
27-102	17-beta-hydroxysteroid dehydrogenases, such as HSD17B14, are primarily involved in metabolism of steroids at the C17 position and also of other substrates, such as fatty acids, prostaglandins, and xen	0.05 mg	632-Eur	Prosci	rat
ELOVL7	ELOVL5 Gene ELOVL family member 5, elongation of long chain fatty acids (FEN1_Elo2, SUR4_Elo3-like, yeast)		----Eur	Transposagen
bs-2096P	Peptides: SLC4A4(solute carrier family 4:sodium bicarbonate cotransporter NBC1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
25-897	SLC25A11 catalyzes the transport of 2-oxoglutarate across the inner mitochondrial membrane in an electroneutral exchange for malate or other dicarboxylic acids, and plays an important role in several	0.05 mg	632-Eur	Prosci	cat
SMC-389D	CNGA1_3, S36-12 Monoclonals AntibodiesS36-12 Fusion protein amino acids 535-637 (cytoplasmic Cterminus) of goldfish CNG, accession number AAO16601.	100ug	324-Eur	Stressmarq
SMC-338D	PAN SAPAP, S127-31 Monoclonals AntibodiesS127-31 Fusion protein amino acids 772-992 (C-terminus) of rat SAPAP1, accession number P97836.	100ug	324-Eur	Stressmarq
30-510	GGTL3 is an enzymes involved in both the metabolism of glutathione and in the transpeptidation of amino acids. Changes in the activity of gamma-glutamyltransferase may signal preneoplastic or toxic co	0.05 mg	632-Eur	Prosci
bs-1214P	Peptides: TRAIL_Apo2L (tumor necrosis factor-related apoptosis-inducing ligand) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1530P	Peptides: Slc4a7_Nbcn1(solute carrier family 4, sodium bicarbonate cotransporter, member 7) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
ELP2	ELOVL6 Gene ELOVL family member 6, elongation of long chain fatty acids (FEN1_Elo2, SUR4_Elo3-like, yeast)		----Eur	Transposagen
SMC-330D	BK channel BETA3, S40B-18 Monoclonals AntibodiesS40B-18 Fusion protein amino acids 1-49 (unique N-terminus) of mouse BKBeta3a	100ug	324-Eur	Stressmarq
26-381	GGTL3 is an enzymes involved in both the metabolism of glutathione and in the transpeptidation of amino acids. Changes in the activity of gamma-glutamyltransferase may signal preneoplastic or toxic co	0.05 mg	632-Eur	Prosci
25-689	WDR4 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate fo	0.05 mg	632-Eur	Prosci
30-941	IFT122 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate	0.05 mg	632-Eur	Prosci
SMC-383D	Mslo maxi- K+ channel, S6-60 Monoclonals AntibodiesS6-60 Fusion protein amino acids 690-1196 (cytoplasmic C-terminus) of mouse Slo1	100ug	324-Eur	Stressmarq
29-552	WDR4 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate fo	0.1 mg	496-Eur	Prosci
29-551	WDR12 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate f	0.1 mg	496-Eur	Prosci
SMC-326D	mSlo3, S2-16 Monoclonals AntibodiesS2-16 Fusion protein amino acids 1052-1121 of mouse Slo3; accession number AAB99742	100ug	324-Eur	Stressmarq
B1122	Lactalbumin Hydrolysate USE : For rich in essential amino acids and can be successfully used to supplement Tissue Culture media where viral vaccine are produced.	5x500gm	386-Eur	biomarkt
25-973	WDR33 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate f	0.05 mg	632-Eur	Prosci
B1122	Lactalbumin Hydrolysate USE For rich in essential amino acids and can be successfully used to supplement Tissue Culture media where viral vaccine are produced.	Qty per Litre of Medium:	5-Eur	biomarkt	cell culture
29-549	WDR13 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate f	0.1 mg	496-Eur	Prosci
MEL13-500ML	Cell Culture Media,Minimum Essentials Medium,EMEM,With Earle's salts, L-glutamine, and nonessential amino acids.	500ml	56-Eur	Caisson Laboratory
MEL13-1000ML	Cell Culture Media,Minimum Essentials Medium,EMEM,With Earle's salts, L-glutamine, and nonessential amino acids.	1000ml	----Eur	Caisson Laboratory
MEL33-500ML	Cell Culture Media,Minimum Essentials Medium,HMEM,With Hank's salts, nonessential amino acids, and L-glutamine.	500ml	68-Eur	Caisson Laboratory
26-310	WDR34 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate f	0.05 mg	632-Eur	Prosci
29-550	WDR6 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate fo	0.05 mg	632-Eur	Prosci
orb80059	Rat IL3 protein IL3 Rat Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 140 amino acids and having a molecular mass of 16 kDa. The IL-3 is purified by proprie	2	154-Eur	Biorb	recombinant
EGE-237	Nucleic acids: pLEXSY-red-sat2 integrative constitutive control vector with Ds geneantibiotic selection of transfectants with LEXSY NTC and expression monitoring with Ds red fluorescence	5	467-Eur	Jena Bio
SMC-381D	WAVE1-Scar, S91-36 Monoclonals AntibodiesS91-36 Synthetic peptide amino acids 477-498 of human Wave1_Wasp family1, accession number Q92558	100ug	324-Eur	Stressmarq
26-009	The mitochondrial oxidation of long-chain fatty acids is initiated by the sequential action of carnitine palmitoyltransferase I (which is located in the outer membrane and is detergent-labile) and car	0.05 mg	632-Eur	Prosci	cat
26-324	MBOAT1 shares structural similarity with a superfamily of membrane-bound O-acetyltransferases that transfer organic compounds, usually fatty acids (e.g., cholesterol, diacylglycerol, palmitoyl), onto	0.05 mg	632-Eur	Prosci
orb80423	Rat IL4 protein IL4 Rat Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 126 amino acids and having a molecular mass of 14105 Dalton. The IL-4 is purified by p	2	154-Eur	Biorb	recombinant
SMC-352D	Kv1.2 Antibody Monoclonal, Clone number: S14-16 Host: Mouse, Isotype: IgG2b Immunogen: Fusion protein amino acids 428-499 (cytoplasmic C-terminus) of rat Kv1.2	100ug	279-Eur	Stressmarq
SMC-377D	Kv4.3 Antibody Monoclonal, Clone number: S75-41 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 415-636 (cytoplasmic C-temrinus) of rat Kv4.3	100ug	279-Eur	Stressmarq
orb80052	Rat IL1 beta protein IL1b Rat Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 152 amino acids and having a molecular mass of 17.3 kDa. The IL-1b is purified by proprie	2	154-Eur	Biorb	recombinant
B1172	Lactalbumin Hydrolysate, Certified USE For rich in essential amino acids and can be successfully used to supplement Tissue Culture media where viral vaccine are produced.	Qty per Litre of Medium:	6-Eur	biomarkt	cell culture
orb80912	Human Annexin A1 protein ANXA1produced in E.coli is a single, non-glycosylated polypeptide chain containing 346 amino acids (1-207 a.a.) and having a molecular mass of 38.7 kDa.ANXA1 is purified by pr	2	244-Eur	Biorb	recombinant
SMC-349D	Kv1.5 Antibody Monoclonal, Clone number: S7-45 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 542-602 (Cytoplasmic C-terminus) of rat Kv1.5	100ug	279-Eur	Stressmarq
orb80015	Rat EGF protein EGF Rat Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 53 amino acids and having a molecular mass of 6151 Dalton. The Rat EGF is purified by	20	154-Eur	Biorb	recombinant
bs-0396P	Peptides: VCAM-1_CD106(Vascular cell adhesion molecule 1 isoform b precusor; CD106 antigen) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
SMC-183D	p53 Antibody Monoclonal, Clone number: Pab 1801 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein (Human), amino acids 46-53	100ug	229-Eur	Stressmarq
orb80065	Rat IL6 protein IL6 Rat Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 187 amino acids and having a molecular mass of 21732 Dalton. The IL6 is purified by pr	2	154-Eur	Biorb	recombinant
B1172	Lactalbumin Hydrolysate, Certified USE : For rich in essential amino acids and can be successfully used to supplement Tissue Culture media where viral vaccine are produced.	5x500gm	451-Eur	biomarkt
orb80025	Rat FGF basic protein bFGF Rat Recombinant (FGF-2) produced in E.coli is a single, non-glycosylated, polypeptide chain containing 145 amino acids and having a molecular mass of 16.3 kDa.The bFGF2 is p	10	154-Eur	Biorb	recombinant
SMC-347D	Thorase_Atad1, S125-10 Monoclonals AntibodiesS125-10 Fusion protein amino acids 1-361 (Full length) of mouse Thorase, accession number Q9D5TO`	100ug	324-Eur	Stressmarq
SMC-318D	CaVbeta4 Antibody Monoclonal, Clone number: S10-7 Host: Mouse, Isotype: IgG1 Immunogen: Synthetic peptide amino acids 458-474 of rat CavB4	100ug	279-Eur	Stressmarq
orb80427	Rat IL5 protein IL5 Rat Recombinant produced in E.coli is dimeric, non-glycosylated polypeptide chain containing 113 amino acids and having a molecular mass of 13074 Dalton.The IL-5 is purified by pro	2	154-Eur	Biorb	recombinant
orb81428	Human TNF receptor-Associated Factor 2 protein TRAF2 produced in E.coli is a single, non-glycosylated polypeptide chain containing 119 amino acids (1-119 a.a.) and having a molecular mass of 13.6 kDa.	10	154-Eur	Biorb	recombinant
orb80415	Rat IL2 protein IL2 Rat Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 134 amino acids and having a molecular mass of 17kDa. The IL-2 is purified by propriet	5	154-Eur	Biorb	recombinant
bs-0812P	Peptides: IL-1 Beta(Interleukin-1 Beta) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1611-RHO14	Nucleic acids: 7-Propargylamino-7-deaza-dATP - ATTO-Rho14	40	746-Eur	Jena Bio
bs-0555P	Peptides: IL-1 Alpha (Interleukin-1 Alpha ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0110P	Peptides: Fe65 protein peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1611-RHO13	Nucleic acids: 7-Propargylamino-7-deaza-dATP - ATTO-Rho13	40	746-Eur	Jena Bio
bs-2585P	Peptides: FOXF1(Forkhead box protein F1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1611-540Q	Nucleic acids: 7-Propargylamino-7-deaza-dATP - ATTO-540Q	40	746-Eur	Jena Bio
NU-812-BIO	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - Biotin, pack	50	172-Eur	Jena Bio
bs-0800P	Peptides: ANGPTL1_ANG-1 (Angiopoietin-like Protein 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
P0005	Proteins: bovine Insulin protein Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
NU-1611-RHO6G	Nucleic acids: 7-Propargylamino-7-deaza-dATP - ATTO-Rho6G	40	746-Eur	Jena Bio
NU-1611-THIO12	Nucleic acids: 7-Propargylamino-7-deaza-dATP - ATTO-Thio12	40	746-Eur	Jena Bio
bs-2258P	Proteins: rh-TNF alpha protein GST Tagged Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
NU-1612-RHO13	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - ATTO-Rho13	80	746-Eur	Jena Bio
NU-1612-RHO14	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - ATTO-Rho14	80	746-Eur	Jena Bio
NU-1612-RHO6G	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - ATTO-Rho6G	80	746-Eur	Jena Bio
bs-0844P	Peptides: GFP (Green Fluorecent protein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1612-THIO12	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - ATTO-Thio12	80	746-Eur	Jena Bio
bs-0822P	Peptides: TDP-43_TARDBP (tar DNA binding protein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1611-612Q	Nucleic acids: 7-Propargylamino-7-deaza-dATP - ATTO-612Q	40	746-Eur	Jena Bio
NU-1611-580Q	Nucleic acids: 7-Propargylamino-7-deaza-dATP - ATTO-580Q	40	746-Eur	Jena Bio
NU-812L	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate, L pack	150Units	316-Eur	Jena Bio
NU-1611-RHO12	Nucleic acids: 7-Propargylamino-7-deaza-dATP - ATTO-Rho12	40	746-Eur	Jena Bio
PM-115	Nucleic acids: P1510 odc reverse primer(for integration diagnostics of all odc integration vectors)	2,5nmol	56-Eur	Jena Bio
NU-1611-647N	Nucleic acids: 7-Propargylamino-7-deaza-dATP - ATTO-647N	40	746-Eur	Jena Bio
bs-1287P	Peptides: IKB Alpha (Inhibitor of KB Alpha) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0380P	Peptides: MBP(Myelin Basic Protein, MBP 68-86) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1615-580Q	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - ATTO-580Q	40	1095-Eur	Jena Bio
NU-1612-RHO12	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - ATTO-Rho12	80	746-Eur	Jena Bio
bs-0191P	Peptides: HSP-60( Heat shock protein-60) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0855P	Proteins: Insulin protein (Active) Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-1397P	Peptides: CBP(CREB-binding protein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1611-RHO101	Nucleic acids: 7-Propargylamino-7-deaza-dATP - ATTO-Rho101	40	746-Eur	Jena Bio
NU-1612-RHO11	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - ATTO-Rho11	80	746-Eur	Jena Bio
bs-0121P	Peptides: SAP-1 (Synapse associated protein-I) peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0618P	Peptides: hypothetical protein (LOC55652) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1615-540Q	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - ATTO-540Q	40	1095-Eur	Jena Bio
DL-ELOVL1-Ra	Rat Elongation Of Very Long Chain Fatty Acids Like Protein 1 (ELOVL1) ELISA Kit	96T	907-Eur	Yukichj	Elisa kits
NU-1612-RHO101	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - ATTO-Rho101	80	746-Eur	Jena Bio
NU-1612-647N	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - ATTO-647N	80	746-Eur	Jena Bio
bs-1387P	Peptides: HSP-105 (heat sock protein-105) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1611-RHO11	Nucleic acids: 7-Propargylamino-7-deaza-dATP - ATTO-Rho11	40	746-Eur	Jena Bio
bs-2159P	Peptides: Glypican 4(Glypican proteoglycan 4) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-811-BIO	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - Biotin, pack	50	172-Eur	Jena Bio
NU-1612-540Q	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - ATTO-540Q	80	746-Eur	Jena Bio
NU-1612-580Q	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - ATTO-580Q	80	746-Eur	Jena Bio
NU-811L	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate, L pack	150Units	316-Eur	Jena Bio
bs-1418P	Peptides: BOb-1(B-cell oct-binding protein 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0890P	Peptides: GFP (Green Fluorecent protein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1612-612Q	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - ATTO-612Q	80	746-Eur	Jena Bio
NU-1615-647N	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - ATTO-647N	40	1095-Eur	Jena Bio
NU-1615-612Q	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - ATTO-612Q	40	1095-Eur	Jena Bio
NU-811S	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate, S pack	30Units	128-Eur	Jena Bio
NU-812S	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate, S pack	30Units	128-Eur	Jena Bio
bs-0865P	Peptides: Tachyplesin I(Tachyplesin-1 precursor ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0341P	Peptides: CKR-L2( G protein-coupled receptor-2 ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1131P	Peptides: SNAP-25 (synaptosomal-associated protein 25) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1618-THIO12	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - ATTO-Thio12	80	1175-Eur	Jena Bio
bs-1689P	Peptides: MKK3(MAP Kinase Kinase 3) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1618-RHO14	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - ATTO-Rho14	80	1175-Eur	Jena Bio
NU-1618-RHO13	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - ATTO-Rho13	80	1175-Eur	Jena Bio
NU-1618-RHO12	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - ATTO-Rho12	80	1175-Eur	Jena Bio
bs-0253P	Peptides: ER- Alpha _ER alpha peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1618-RHO11	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - ATTO-Rho11	80	1175-Eur	Jena Bio
bs-2035P	Peptides: LIS1(Lissencephaly-1 protein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1618-RHO101	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - ATTO-Rho101	80	1175-Eur	Jena Bio
NU-1618-RHO6G	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - ATTO-Rho6G	80	1175-Eur	Jena Bio
orb80574	Human CD4 (26-226) protein CD-4 Human Recombinant encoding amino acids 26-226. For research use only.	2	277-Eur	Biorb	recombinant
PHP055	RECOMBINANT HUMAN INTERLEUKIN-8 (72 AMINO ACIDS) Recombinant Protein Host: N_A	25	353-Eur	AbD
DNJ30012	DnaJ(Amino acids 1_376), Recombinant, E.coli Source Recombinant	0.2 mg	280-Eur	Assaypro	recombinant
bs-0537P	Peptides: ANGPTL2_ANG-2 (Angiopoietin-like Protein 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1104P	Peptides: TBX2_T-box2(T-box Protein 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1093P	Peptides: CGP-39_YKL-40(Chitinase-3-like protein 1 ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1755P	Peptides: EGFL7(EGF-like domain containing protein 7) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0245P	Peptides: IKI3 family protein Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0658P	Peptides: E.coli O6 (Escherichia coli O6) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1554P	Peptides: AQP5(aquaporin Protein-5) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0038P	Peptides: GLP-1(Glucagon-like peptide-1)(7-36)peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0046P	Peptides: NTP，Neurual thread protein Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1805P	Peptides: IL-6R Alpha (IL6R-alpha) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1816P	Peptides: Integrin a7(integrin alpha 7) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1847P	Peptides: MAP1A_Mtap1a(microtubule associated protein 1A) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2441P	Peptides: TWIST protein peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0235P	Peptides: PMP-22(Peripheral Myelin Protein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
SMC-369D	SAP97, S64-15 Monoclonals AntibodiesS64-15 Fusion protein amino acids 1-104 of rat SAP97	100ug	324-Eur	Stressmarq
bs-1041P	Peptides: MAPKK1 (MAP kinase kinase 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1040P	Peptides: factor V(Vcoagulation factor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
DNJ30015	DnaJ(Amino acids 1_376), Recombinant, E.coli Source Recombinant	1 mg	1058-Eur	Assaypro	recombinant
bs-0267P	Peptides: Akt_PKC(Protein Kinase C,PKC) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2144P	Peptides: Snake poison Protein Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
PHP210	RECOMBINANT HUMAN DEFENSIN BETA 1 (36 AMINO ACIDS)-RECOMBINANT PROTEIN	20 Mg	342-Eur	AbD	recombinant
PM-114	Nucleic acids: A1304 odc forward primer(for integration diagnostics of all odc integration vectors)	2,5nmol	56-Eur	Jena Bio
PM-104	Nucleic acids: F3002 ssu reverse primer(for integration diagnostics of all ssu integration vectors)	2,5nmol	56-Eur	Jena Bio
PM-105	Nucleic acids: F3001 ssu forward primer(for integration diagnostics of all ssu integration vectors)	2,5nmol	56-Eur	Jena Bio
bs-2109P	Peptides: V5 tag(recombinant V5-tagged protein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1615-THIO12	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - ATTO-Thio12	40	1095-Eur	Jena Bio
NU-1615-RHO6G	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - ATTO-Rho6G	40	1095-Eur	Jena Bio
NU-1615-RHO14	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - ATTO-Rho14	40	1095-Eur	Jena Bio
NU-1615-RHO12	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - ATTO-Rho12	40	1095-Eur	Jena Bio
NU-1615-RHO11	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - ATTO-Rho11	40	1095-Eur	Jena Bio
NU-1615-RHO101	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - ATTO-Rho101	40	1095-Eur	Jena Bio
bs-2143P	Peptides: Snake poison Protein Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0762P	Peptides: midnolin isoform Protein 2 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1615-RHO13	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - ATTO-Rho13	40	1095-Eur	Jena Bio
bs-0634P	Peptides: AQP4(aquaporin Protein-4) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0761P	Peptides: midnolin isoform Protein 1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1618-647N	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - ATTO-647N	80	1175-Eur	Jena Bio
PHP054	RECOMBINANT HUMAN INTERLEUKIN-8 (77 AMINO ACIDS) Recombinant Protein Host: N_A	25	230-Eur	AbD
NU-1618-612Q	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - ATTO-612Q	80	1175-Eur	Jena Bio
bs-0452P	Peptides: NAIF1 protein( CB12-327) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0639P	Peptides: GFP (Green Fluorecent protein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2060P	Peptides: AQP9(aquaporin Protein-9) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1618-540Q	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - ATTO-540Q	80	1175-Eur	Jena Bio
NU-1618-580Q	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - ATTO-580Q	80	1175-Eur	Jena Bio
bs-0730P	Peptides: HSP-27(Heat Shock Protein 27) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0632P	Peptides: Thioster-containing protein 1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0040P	Peptides: APC(Activated protein C) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-835-RHO12	Nucleic acids: N6-(6-Amino)hexyl-dATP - ATTO-Rho12	40	746-Eur	Jena Bio
bs-0029P	Peptides: PP-2A (protein phosphatase 2A) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-835-RHO11	Nucleic acids: N6-(6-Amino)hexyl-dATP - ATTO-Rho11	40	746-Eur	Jena Bio
bs-0620P	Peptides: histone H3-like protein Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-835-RHO13	Nucleic acids: N6-(6-Amino)hexyl-dATP - ATTO-Rho13	40	746-Eur	Jena Bio
bs-0261P	Peptides: AQP-2 (aquaporin Protein-2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-832L	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP, L pack	500	316-Eur	Jena Bio
NU-835-THIO12	Nucleic acids: N6-(6-Amino)hexyl-dATP - ATTO-Thio12	40	746-Eur	Jena Bio
NU-832-BIO	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - Biotin, pack	50	172-Eur	Jena Bio
bs-0621P	Peptides: histone H3-like protein Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1171L	Nucleic acids: Ara-cytidine-5'-diphosphate (ara-CDP), L pack Cytarabine diphosphate	250Units	316-Eur	Jena Bio
NU-835-RHO14	Nucleic acids: N6-(6-Amino)hexyl-dATP - ATTO-Rho14	40	746-Eur	Jena Bio
01-2205	Antigens DnaJ(Amino acids 1-376), E.coli, Recombinant, E.coli	10	369-Eur	ARP
NU-835-RHO6G	Nucleic acids: N6-(6-Amino)hexyl-dATP - ATTO-Rho6G	40	746-Eur	Jena Bio
bs-0154P	Peptides: GAP-43 ( Growth associated protein-43 ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0343P	Peptides: pre S1_S2 protein [HBV] Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
N-20336-10G	Nucleic acids: 2-Fluoro-2'-fluoro-2'-deoxy-adenosine, 10 g pack	10g	8559-Eur	Jena Bio
NU-916-RHO6G	Nucleic acids: gamma-[6-Aminohexyl]-dGTP - ATTO-Rho6G	10	209-Eur	Jena Bio
N-20308-5	Nucleic acids: Arabinofuranosyl-uracil (ara-U), 5 g pack Uracil arabinoside	5g	229-Eur	Jena Bio
N-20308-1	Nucleic acids: Arabinofuranosyl-uracil (ara-U), 1 g pack Uracil arabinoside	1g	86-Eur	Jena Bio
N-20307-5	Nucleic acids: Arabinofuranosyl-cytosin (ara-C), 5 g pack Cytosin arabinoside	5g	179-Eur	Jena Bio
N-20307-1	Nucleic acids: Arabinofuranosyl-cytosin (ara-C), 1 g pack Cytosin arabinoside	1g	72-Eur	Jena Bio
N-20305-250	Nucleic acids: Arabinofuranosyl-adenine (ara-A), 250 mg pack Adenine arabinoside	250mg	68-Eur	Jena Bio
N-20305-1G	Nucleic acids: Arabinofuranosyl-adenine (ara-A), 1 g pack Adenine arabinoside	1g	115-Eur	Jena Bio
N-20305-10G	Nucleic acids: Arabinofuranosyl-adenine (ara-A), 10 g pack Adenine arabinoside	10g	599-Eur	Jena Bio
N-20303-250	Nucleic acids: Arabinofuranosyl-guanine (ara-G), 250 mg pack Guanine arabinoside	250mg	96-Eur	Jena Bio
N-20303-1G	Nucleic acids: Arabinofuranosyl-guanine (ara-G), 1 g pack Guanine arabinoside	1g	172-Eur	Jena Bio
N-20303-10G	Nucleic acids: Arabinofuranosyl-guanine (ara-G), 10 g pack Guanine arabinoside	10g	978-Eur	Jena Bio
bs-0759P	Peptides: Lpin1 protein Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0427P	Peptides: P311 protein Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-835-540Q	Nucleic acids: N6-(6-Amino)hexyl-dATP - ATTO-540Q	40	746-Eur	Jena Bio
bs-2164P	Proteins: reMOG 1-125 protein Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
NU-835-RHO101	Nucleic acids: N6-(6-Amino)hexyl-dATP - ATTO-Rho101	40	746-Eur	Jena Bio
NU-835-647N	Nucleic acids: N6-(6-Amino)hexyl-dATP - ATTO-647N	10	209-Eur	Jena Bio
NU-832S	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP, S pack	100	128-Eur	Jena Bio
NU-1611-485XL	Nucleic acids: 7-Propargylamino-7-deaza-dATP - DY-485XL	40	746-Eur	Jena Bio
NU-1611-480XL	Nucleic acids: 7-Propargylamino-7-deaza-dATP - DY-480XL	40	746-Eur	Jena Bio
N-20336-250	Nucleic acids: 2-Fluoro-2'-fluoro-2'-deoxy-adenosine, 250 mg pack	250mg	580-Eur	Jena Bio
bs-4507P	Peptides: PRRSV M protein Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-835-612Q	Nucleic acids: N6-(6-Amino)hexyl-dATP - ATTO-612Q	40	746-Eur	Jena Bio
N-20336-1G	Nucleic acids: 2-Fluoro-2'-fluoro-2'-deoxy-adenosine, 1 g pack	1g	1309-Eur	Jena Bio
bs-0130P	Peptides: SARS S-protein Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-835-580Q	Nucleic acids: N6-(6-Amino)hexyl-dATP - ATTO-580Q	40	746-Eur	Jena Bio
NU-911-647N	Nucleic acids: gamma-[6-Aminohexyl]-N6-Benzyl-ATP - ATTO-647N	20	209-Eur	Jena Bio
NU-916-540Q	Nucleic acids: gamma-[6-Aminohexyl]-dGTP - ATTO-540Q	20	209-Eur	Jena Bio
N-1002	Nucleic acids: Arabinofuranosyl-hypoxanthine (ara-HX), 1 g pack Hypoxanthine arabinoside	1g	134-Eur	Jena Bio
bs-0910P	Peptides: Batroxobin Protein Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-811-594	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - ATTO-594	40	746-Eur	Jena Bio
NU-811-590	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - ATTO-590	120	746-Eur	Jena Bio
NU-811-565	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - ATTO-565	120	746-Eur	Jena Bio
NU-811-550	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - ATTO-550	80	746-Eur	Jena Bio
NU-811-532	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - ATTO-532	80	746-Eur	Jena Bio
NU-811-495	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - ATTO-495	80	746-Eur	Jena Bio
NU-811-488	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - ATTO-488	80	746-Eur	Jena Bio
NU-811-465	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - ATTO-465	120	746-Eur	Jena Bio
NU-811-425	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - ATTO-425	120	746-Eur	Jena Bio
NU-811-390	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - ATTO-390	80	746-Eur	Jena Bio
NU-306L	Nucleic acids: NPE-caged-GpCpp, L pack (NPE-caged-GMPCPP)	50Units	316-Eur	Jena Bio
NU-305S	Nucleic acids: NPE-caged-AppNHp, S pack (NPE-caged-AMPPNP)	20Units	133-Eur	Jena Bio
NU-419S	Nucleic acids: 6-Thio-GppNHp, S pack (6-Thio-GMPPNP)	30Units	128-Eur	Jena Bio
NU-811-620	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - ATTO-620	40	746-Eur	Jena Bio
NU-811-740	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - ATTO-740	40	746-Eur	Jena Bio
NU-811-725	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - ATTO-725	40	746-Eur	Jena Bio
NU-811-700	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - ATTO-700	40	746-Eur	Jena Bio
NU-418L	Nucleic acids: 6-Thio-GppCp, L pack (6-Thio-GMPPCP)	250Units	316-Eur	Jena Bio
NU-811-665	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - ATTO-665	400	746-Eur	Jena Bio
NU-811-661Q	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - DYQ-661	40	746-Eur	Jena Bio
NU-811-660Q	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - DYQ-660	40	746-Eur	Jena Bio
NU-811-656	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - OYSTER-656	40	746-Eur	Jena Bio
NU-811-655	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - ATTO-655	40	746-Eur	Jena Bio
NU-418S	Nucleic acids: 6-Thio-GppCp, S pack (6-Thio-GMPPCP)	50Units	128-Eur	Jena Bio
NU-811-633	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - ATTO-633	40	746-Eur	Jena Bio
NU-419L	Nucleic acids: 6-Thio-GppNHp, L pack (6-Thio-GMPPNP)	150Units	316-Eur	Jena Bio
NU-207L	Nucleic acids: Mant-GppNHp, L pack (Mant-GMPPNP)	50Units	331-Eur	Jena Bio
NU-1618-485XL	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - DY-485XL	80	1175-Eur	Jena Bio
NU-1619-647N	Nucleic acids: 5-Propargylamino-ddUTP - ATTO-647N	80	746-Eur	Jena Bio
PR-240	CK2 holoenzyme, human, alpha 1 (amino acids 1-335) human, recombinant, E. coli	10	270-Eur	Jena Bio
bs-1048P	Peptides: Podoplanin Protein Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1619-RHO101	Nucleic acids: 5-Propargylamino-ddUTP - ATTO-Rho101	80	746-Eur	Jena Bio
NU-1619-RHO11	Nucleic acids: 5-Propargylamino-ddUTP - ATTO-Rho11	80	746-Eur	Jena Bio
NU-1619-RHO12	Nucleic acids: 5-Propargylamino-ddUTP - ATTO-Rho12	80	746-Eur	Jena Bio
NU-208L	Nucleic acids: Mant-dGppNHp, L pack (Mant-dGMPPNP)	50Units	316-Eur	Jena Bio
NU-207S	Nucleic acids: Mant-GppNHp, S pack (Mant-GMPPNP)	10Units	133-Eur	Jena Bio
NU-1619-RHO13	Nucleic acids: 5-Propargylamino-ddUTP - ATTO-Rho13	80	746-Eur	Jena Bio
bs-0513P	Peptides: Nephrin Protein Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1619-RHO14	Nucleic acids: 5-Propargylamino-ddUTP - ATTO-Rho14	80	746-Eur	Jena Bio
NU-1619-RHO6G	Nucleic acids: 5-Propargylamino-ddUTP - ATTO-Rho6G	80	746-Eur	Jena Bio
NU-1619-612Q	Nucleic acids: 5-Propargylamino-ddUTP - ATTO-612Q	80	746-Eur	Jena Bio
NU-1619-580Q	Nucleic acids: 5-Propargylamino-ddUTP - ATTO-580Q	80	746-Eur	Jena Bio
NU-305L	Nucleic acids: NPE-caged-AppNHp, L pack (NPE-caged-AMPPNP)	100Units	331-Eur	Jena Bio
bs-0512P	Peptides: CD2AP (CD2-associated protein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0470P	Peptides: BGP(Bone Gla-protein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
PHP054	RECOMBINANT HUMAN INTERLEUKIN-8 (77 AMINO ACIDS)-RECOMBINANT PROTEIN	25 |g	342-Eur	AbD	recombinant
NU-214S	Nucleic acids: Mant-AppNHp, S pack (Mant-AMPPNP)	10Units	133-Eur	Jena Bio
NU-214L	Nucleic acids: Mant-AppNHp, L pack (Mant-AMPPNP)	50Units	331-Eur	Jena Bio
NU-211S	Nucleic acids: Mant-XppNHp, S pack (Mant-XMPPNP)	5Units	128-Eur	Jena Bio
NU-211L	Nucleic acids: Mant-XppNHp, L pack (Mant-XMPPNP)	25Units	316-Eur	Jena Bio
PHP055	RECOMBINANT HUMAN INTERLEUKIN-8 (72 AMINO ACIDS)-RECOMBINANT PROTEIN	25 |g	529-Eur	AbD	recombinant
bs-0483P	Peptides: histone H3-like protein Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-208S	Nucleic acids: Mant-dGppNHp, S pack (Mant-dGMPPNP)	10Units	128-Eur	Jena Bio
NU-1619-540Q	Nucleic acids: 5-Propargylamino-ddUTP - ATTO-540Q	80	746-Eur	Jena Bio
NU-1619-THIO12	Nucleic acids: 5-Propargylamino-ddUTP - ATTO-Thio12	80	746-Eur	Jena Bio
NU-812-MNT	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - MANT	200	746-Eur	Jena Bio
NU-812-660Q	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - DYQ-660	40	746-Eur	Jena Bio
NU-811-680	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - ATTO-680	40	746-Eur	Jena Bio
NU-812-725	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - ATTO-725	40	746-Eur	Jena Bio
NU-1612-480XL	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - DY-480XL	80	746-Eur	Jena Bio
NU-812-665	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - ATTO-665	400	746-Eur	Jena Bio
bs-1369P	Peptides: MAP-2(microtubule associated protein 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-812-656	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - OYSTER-656	40	746-Eur	Jena Bio
NU-812-655	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - ATTO-655	40	746-Eur	Jena Bio
NU-812-633	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - ATTO-633	40	746-Eur	Jena Bio
NU-812-661Q	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - DYQ-661	40	746-Eur	Jena Bio
NU-812-680	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - ATTO-680	40	746-Eur	Jena Bio
NU-1612-485XL	Nucleic acids: 7-Propargylamino-7-deaza-ddATP - DY-485XL	80	746-Eur	Jena Bio
NU-812-MB2	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - ATTO-MB2	40	746-Eur	Jena Bio
NU-812-TAM	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - 5_6-TAMRA	160	746-Eur	Jena Bio
NU-417L	Nucleic acids: 6-Thio-GpCp, L pack (6-Thio-GMPCP)	150Units	316-Eur	Jena Bio
NU-1615-480XL	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - DY-480XL	40	1095-Eur	Jena Bio
NU-812-TXR	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - Texas Red	160	746-Eur	Jena Bio
NU-1615-485XL	Nucleic acids: 7-Propargylamino-7-deaza-dGTP - DY-485XL	40	1095-Eur	Jena Bio
NU-812-740	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - ATTO-740	40	746-Eur	Jena Bio
bs-0520P	Peptides: PKA(Protein Kinase A) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-812-700	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - ATTO-700	40	746-Eur	Jena Bio
NU-812-620	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - ATTO-620	40	746-Eur	Jena Bio
NU-308S	Nucleic acids: NPE-caged-XppNHp, S pack (NPE-caged-XMPPNP)	5Units	128-Eur	Jena Bio
NU-812-465	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - ATTO-465	120	746-Eur	Jena Bio
NU-812-425	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - ATTO-425	120	746-Eur	Jena Bio
NU-812-390	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - ATTO-390	80	746-Eur	Jena Bio
NU-811-TXR	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - Texas Red	160	746-Eur	Jena Bio
NU-811-TAM	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - 5_6-TAMRA	160	746-Eur	Jena Bio
NU-308L	Nucleic acids: NPE-caged-XppNHp, L pack (NPE-caged-XMPPNP)	25Units	316-Eur	Jena Bio
NU-811-MNT	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - MANT	200	746-Eur	Jena Bio
NU-811-MB2	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - ATTO-MB2	40	746-Eur	Jena Bio
bs-0931P	Peptides: Histone H1b(Histone H1.4) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-306S	Nucleic acids: NPE-caged-GpCpp, S pack (NPE-caged-GMPCPP)	10Units	128-Eur	Jena Bio
NU-812-488	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - ATTO-488	80	746-Eur	Jena Bio
NU-812-495	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - ATTO-495	80	746-Eur	Jena Bio
NU-1618-480XL	Nucleic acids: 7-Propargylamino-7-deaza-ddGTP - DY-480XL	80	1175-Eur	Jena Bio
NU-812-565	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - ATTO-565	120	746-Eur	Jena Bio
NU-812-550	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - ATTO-550	80	746-Eur	Jena Bio
NU-812-590	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - ATTO-590	120	746-Eur	Jena Bio
NU-417S	Nucleic acids: 6-Thio-GpCp, S pack (6-Thio-GMPCP)	30Units	128-Eur	Jena Bio
NU-812-594	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - ATTO-594	40	746-Eur	Jena Bio
NU-812-532	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - ATTO-532	80	746-Eur	Jena Bio
bs-0251P	Peptides: RAR-Alpha (Retinoic acid -R-Alpha) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1437P	Peptides: MRP5_ABCC5(Multidrug Resistanec-Associated Protein 5) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1171S	Nucleic acids: Ara-cytidine-5'-diphosphate (ara-CDP), S pack Cytarabine diphosphate, Sodium salt	50Units	128-Eur	Jena Bio
bs-1283P	Peptides: ASPP2(apoptosis stimulating protein of P53 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0657P	Peptides: MRP1(Multidrug Resistanec-Associated Protein 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1053P	Peptides: CCP peptide (cyclic citrullinated peptide,CCP) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1778P	Peptides: GATA-4(GATA binding factor 4) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1538P	Peptides: HSP47(Heat shock protein-47) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1436P	Peptides: RKIP(Raf kinase inhibitor protein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1282P	Peptides: ASPP1(apoptosis stimulating protein of P53 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
DL-ELOVL1-Hu	Human ngation Of Very Long Chain Fatty Acids Like Protein 1 (ELOVL1) ELISA Kit	96T	919-Eur	Yukichj	Elisa kits
orb60655	L-Glutamine L-Glutamine is one of the 20 amino acids encoded by the standard genetic code. For research use only.	10 mg	226-Eur	Biorb
bs-0479P	Peptides: VSIG4 (V-set and immunoglobulin domain-containing protein 4) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0260P	Peptides: Insulin Receptor-Alpha(ISR-Alpha) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1170L	Nucleic acids: Ara-cytidine-5'-triphosphate (ara-CTP), L pack Cytarabine triphosphate, Sodium salt	500Units	331-Eur	Jena Bio
NU-1170S	Nucleic acids: Ara-cytidine-5'-triphosphate (ara-CTP), S pack Cytarabine triphosphate, Sodium salt	100Units	133-Eur	Jena Bio
bs-0087P	Peptides: active Caspase 3(caspase-3 p12 subunit) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1754P	Peptides: ECP(eosinophil cationic protein)mouse rat Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0600P	Peptides: AR Alpha1( Alpha1-adrenergic receptor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1165P	Peptides: Beta-catenin_ Beta-cats Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0481P	Peptides: IFN- Gamma(Interferon Gamma)Human Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0319P	Peptides: glycoprotein (E1 glycoprotein) [Rubella virus] Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0480P	Peptides: IFN- Gamma(Interferon Gamma)Ag-mouse、rat Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1617P	Peptides: LI-cadherin(liver-intestine cadherin) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
SPC-165C	PUMA (NT) Polyclonals Ab, Host Rabbit N-terminal amino acids of human PUMA	25ug	181-Eur	Stressmarq
SPC-165D	PUMA (NT) Polyclonals Ab, Host Rabbit N-terminal amino acids of human PUMA	100ug	324-Eur	Stressmarq
bs-1578P	Peptides: human IFN- Alpha (Interferon Alpha ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1504P	Peptides: RAP1A (RAS-related protein-1a precursor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0079P	Peptides: CD19(B-lymphocyte antigen CD19) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0616P	Peptides: CCP peptide (cyclic citrullinated peptide,CCP) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1616P	Peptides: CAP2(Adenylyl cyclase-associated protein 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1219P	Peptides: GRP78(glucose regulated protein 78) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
orb60715	D-glutamine D-glutamine is one of the 20 amino acids encoded by the standard genetic code. For research use only.	10 mg	203-Eur	Biorb
bs-1452P	Peptides: GATA-3(GATA binding factor 3) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
PHP210	RECOMBINANT HUMAN DEFENSIN BETA 1 (36 AMINO ACIDS) Recombinant Protein Host: N_A	20	230-Eur	AbD
bs-0656P	Peptides: MRP3(Multidrug Resistanec-Associated Protein 3) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0290P	Peptides: Insulin Receptor- Beta(ISR- Beta) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1148L	Nucleic acids: 6-Mercaptopurine-riboside-5'-monophosphate, L pack 6-Thio-Inosine-5'-monophosphate	500Units	316-Eur	Jena Bio
bs-1747P	Peptides: DRD5 receptor(dopamine D5 receptor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0047P	Peptides: Insulin Receptor-Alpha(ISR-Alpha) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1743P	Peptides: DRD3 receptor(dopamine D3 receptor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1687P	Peptides: DAPK1(Death associated protein kinase 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1148S	Nucleic acids: 6-Mercaptopurine-riboside-5'-monophosphate, S pack 6-Thio-Inosine-5'-monophosphate	100Units	128-Eur	Jena Bio
bs-0317P	Peptides: ILK-1 (Integrin-linked protein kinase 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1052P	Peptides: NAP1 (nucleosome assembly protein 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0849P	Peptides: apoA1 (Apolipoprotein_APOA1 protein )human Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0789P	Proteins: Insulin protein (from porcine pancreas) Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-1380P	Peptides: GPR30(G Protein Coupled Receptor 30) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
PM-113	Nucleic acids: E159 tub reverse primer(for integration diagnostics of all beta-tub integration vectors)	2,5nmol	56-Eur	Jena Bio
PM-112	Nucleic acids: E158 tub forward primer(for integration diagnostics of all beta-tub integration vectors)	2,5nmol	56-Eur	Jena Bio
TS 022	VITAMINS GROWTH SUPPLEMENT (VITAMINS AND AMINO ACIDS MIXTURE) (DOUBLE PACK) (Store below 8ºC)	5 vl	99-Eur	TitanBiotech
bs-2147P	Peptides: pre-X protein(CT)[Hepatitis B virus C-Terminus] Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2146P	Peptides: pre-X protein[Hepatitis B virus]N-Terminus Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0933P	Peptides: GLP-1_KG-31(Glucagon-like peptide-1) peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
orb81525	Der P1 protein The E.coli derived recombinant protein contains the Der P1 epitopes 114-192 amino acids. For research use only.	100	228-Eur	Biorb	recombinant
orb81526	Der F1 protein The E.coli derived recombinant protein contains the Der F1 epitopes 25-51, 74-95, 189-209 amino acids. For research use only.	100	228-Eur	Biorb	recombinant
DL-ELOVL1-Hu	Human Elongation Of Very Long Chain Fatty Acids Like Protein 1 (ELOVL1) ELISA Kit	96T	837-Eur	Yukichj	Elisa kits
bs-0948P	Peptides: Collagen III (Anti--Collagen Type III ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0182P	Peptides: PTP-1B (Protein-tyrosine phosphatase, non-receptor ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-OXEL009-2	Nucleic acids: Ara-adenosine-5'-monophosphate (ara-AMP), 2 mg pack Vidarabine monophosphate, Sodium salt	2mg	725-Eur	Jena Bio
NU-1110L	Nucleic acids: 6-Mercaptopurine-riboside-5'-triphosphate, L pack 6-Thio-Inosine-5'-triphosphate	500Units	316-Eur	Jena Bio
bs-0787P	Peptides: IFN- Beta (Interferon Beta) human Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0549P	Peptides: Collagen III (Anti-Collagen Type III ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2163P	Peptides: RNF148(Ring finger protein 148) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2599P	Peptides: DDB2(DNA damage-binding protein 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0853P	Peptides: VAP1(vascular adhesion protein 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0558P	Peptides: Emp1 (epithelial membrane protein 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
N-PYA11092-1G	Nucleic acids: Pyrrolo-C, 1 g pack 6-Methyl-3-(beta-D-2-ribofuranosyl)pyrrolo[2,3-d]pyrimidin-2-one	1g	2181-Eur	Jena Bio
bs-1374P	Peptides: BMP4(bone morphogenetic protein 4) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0885P	Peptides: phospho-Tau protein (pThr489) peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0818P	Peptides: MrpL28 (mitochondrial ribosomal protein L28) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0886P	Peptides: Measles virus of fusion protein Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1379P	Peptides: RXR Alpha(retinoid-X receptor alpha) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0552P	Peptides: Collagen V (Anti--Collagen Type V ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
N-PYA11092-100	Nucleic acids: Pyrrolo-C, 100 mg pack 6-Methyl-3-(beta-D-2-ribofuranosyl)pyrrolo[2,3-d]pyrimidin-2-one	100mg	489-Eur	Jena Bio
bs-4536P	Proteins: Streptococcus suis 2 (Cell protein) Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
N-PYA11090-100	Nucleic acids: Pyrrolo-dC, 100 mg pack 6-Methyl-3-(beta-D-2-deoxyribofuranosyl)pyrrolo[2,3-d] pyrimidin-2-one	100mg	705-Eur	Jena Bio
bs-2166P	Peptides: MYSM1(Myb-like, SWIRM and MPN domain-containing protein 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
N-PYA11090-10	Nucleic acids: Pyrrolo-dC, 10 mg pack 6-Methyl-3-(beta-D-2-deoxyribofuranosyl)pyrrolo[2,3-d] pyrimidin-2-one	10mg	199-Eur	Jena Bio
bs-0949P	Peptides: F1 operon positive regulatory protein(NT) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-OXEL005-2	Nucleic acids: Ara-cytidine-5'-monophosphate (ara-CMP), 2 mg pack Cytarabine monophosphate, Sodium salt	2mg	725-Eur	Jena Bio
bs-0950P	Peptides: F1 operon positive regulatory protein(CT) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0729P	Peptides: BK channel (stretch-activated Kca channel) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1296P	Peptides: Defensin Beta2_beta-defensin 2_BD-2(rat) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0112P	Peptides: APP695-770 (Amyloid protein precursor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0501P	Peptides: JNK1_3 (c-Jun amino-terminal kinase 1_3) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0516P	Peptides: RAR- Beta(Retinoic acid -R- Beta) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1111S	Nucleic acids: Ara-adenosine-5'-triphosphate (ara-ATP), S pack Vidarabine triphosphate, Sodium Salt	50Units	128-Eur	Jena Bio
bs-1416P	Peptides: Ah Receptor(Aryl Hydrocarbon Receptor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0700P	Peptides: NSBP1(Nucleosome-binding protein 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1185P	Peptides: TRAF3_CD40bp (CD40 binding protein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2032P	Peptides: PMP2_FABP8(peripheral myelin protein 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1111L	Nucleic acids: Ara-adenosine-5'-triphosphate (ara-ATP), L pack Vidarabine triphosphate, Sodium Salt	250Units	316-Eur	Jena Bio
HSP05015	HSP 90 (amino acids 1_732), Human, Recombinant, His_tag, E.coli Source Recombinant	1 mg	1459-Eur	Assaypro	recombinant
bs-0511P	Peptides: FADD (Fas-associated protein with death domain) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0670P	Peptides: C-jun_AP-1 (Oncoprotein C-jun：active protein 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1110S	Nucleic acids: 6-Mercaptopurine-riboside-5'-triphosphate, S pack 6-Thio-Inosine-5'-triphosphate	100Units	128-Eur	Jena Bio
bs-1410P	Peptides: CTBP1(C-terminal binding protein 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1047P	Peptides: MyD88 (myeloid differential protein-88) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0574P	Peptides: Dynamin 2(Anti-Human Dynamin-2 ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
SMC-183D	p53, Pab 1801 Monoclonals AntibodiesPab 1801 Fusion protein (Human), amino acids 46-53	100ug	272-Eur	Stressmarq
bs-0578P	Peptides: Collagen I(Anti-Collagen Type I) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2031P	Peptides: MBP (Myelin Basic Protein, Rat)peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0964P	Peptides: TRIM32(tripartite motif protein 32) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0402P	Peptides: HCCR-1(BRI3 binding protein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
HSP05012	HSP 90 (amino acids 1_732), Human, Recombinant, His_tag, E.coli Source Recombinant	0.2 mg	436-Eur	Assaypro	recombinant
CLK-AA005-500	Amino acids or its derivatives: 4-Azido-L-homoalanine HCl, 500 mg pack (S)-2-Amino-4-azidobutanoic acid hydrochloride	500mg	899-Eur	Jena Bio
CLK-AA006-10	Amino acids or its derivatives: 4-Azido-D-homoalanine HCl, 10 mg pack (R)-2-Amino-4-azidobutanoic acid hydrochloride	10mg	146-Eur	Jena Bio
CLK-AA005-5	Amino acids or its derivatives: 4-Azido-L-homoalanine HCl, 5 mg pack (S)-2-Amino-4-azidobutanoic acid hydrochloride	5mg	106-Eur	Jena Bio
CLK-AA004-5	Amino acids or its derivatives: 3-Azido-D-alanine HCl, 5 mg pack (R)-2-Amino-3-azidopropanoic acid hydrochloride	5mg	106-Eur	Jena Bio
bs-1281P	Peptides: XIAP(X-linked Inhibitor of Apoptosis Protein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1365P	Peptides: Tsg101(Tumor susceptibility gene 101 protein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0093P	Peptides: TNF- Beta(Tumor Necrosis Factor- Beta) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CLK-AA004-500	Amino acids or its derivatives: 3-Azido-D-alanine HCl, 500 mg pack (R)-2-Amino-3-azidopropanoic acid hydrochloride	500mg	899-Eur	Jena Bio
bs-0255P	Peptides: ER- Beta (Estrogen receptor-beta) peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CLK-AA010-10	Amino acids or its derivatives: 6-Azido-D-lysine HCl, 10 mg pack (R)-2-Amino-6-azidohexanoic acid hydrochloride	10mg	146-Eur	Jena Bio
CLK-AA005-10	Amino acids or its derivatives: 4-Azido-L-homoalanine HCl, 10 mg pack (S)-2-Amino-4-azidobutanoic acid hydrochloride	10mg	146-Eur	Jena Bio
bs-0199P	Peptides: GFAP(Glial Fibrillary Acidic Protein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CLK-AA005-100	Amino acids or its derivatives: 4-Azido-L-homoalanine HCl, 100 mg pack (S)-2-Amino-4-azidobutanoic acid hydrochloride	100mg	392-Eur	Jena Bio
bs-1303P	Peptides: SFRP1(Secreted frizzled related protein 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0116P	Peptides: ER- Beta (Estrogen receptor beta)peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CLK-AA004-100	Amino acids or its derivatives: 3-Azido-D-alanine HCl, 100 mg pack (R)-2-Amino-3-azidopropanoic acid hydrochloride	100mg	392-Eur	Jena Bio
B366	Yeast Nitrogen Base w_o Amino Acids USE: For investigating carbon and nitrogen requirements of yeasts.	5x500gm	----Eur	biomarkt
bs-0100P	Peptides: TGF- Beta2 (Ttansforming Growth Factor – Beta2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1295P	Peptides: Defensin Beta2_beta-defensin 2_BD-2(mouse) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CLK-AA009-100	Amino acids or its derivatives: 6-Azido-L-lysine HCl, 100 mg pack (S)-2-Amino-6-azidohexanoic acid hydrochloride	100mg	392-Eur	Jena Bio
CLK-AA009-5	Amino acids or its derivatives: 6-Azido-L-lysine HCl, 5 mg pack (S)-2-Amino-6-azidohexanoic acid hydrochloride	5mg	106-Eur	Jena Bio
bs-1483P	Peptides: P2P-R_RBBP6(proliferation potential protein related) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CLK-AA009-500	Amino acids or its derivatives: 6-Azido-L-lysine HCl, 500 mg pack (S)-2-Amino-6-azidohexanoic acid hydrochloride	500mg	899-Eur	Jena Bio
bs-1319P	Peptides: MAPK4(Mitogen-activated protein kinase 4) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CLK-AA010-100	Amino acids or its derivatives: 6-Azido-D-lysine HCl, 100 mg pack (R)-2-Amino-6-azidohexanoic acid hydrochloride	100mg	392-Eur	Jena Bio
bs-1330P	Peptides: CKIP-1(casein kinase 2 interaction protein 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CLK-AA009-10	Amino acids or its derivatives: 6-Azido-L-lysine HCl, 10 mg pack (S)-2-Amino-6-azidohexanoic acid hydrochloride	10mg	146-Eur	Jena Bio
CLK-AA006-500	Amino acids or its derivatives: 4-Azido-D-homoalanine HCl, 500 mg pack (R)-2-Amino-4-azidobutanoic acid hydrochloride	500mg	899-Eur	Jena Bio
bs-1341P	Peptides: Cdc2_P34CDC2_CDK1(Cell division control protein 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1447P	Peptides: HIF-2 Alpha (Hypoxia-inducible factor-2 Alpha) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CLK-AA010-5	Amino acids or its derivatives: 6-Azido-D-lysine HCl, 5 mg pack (R)-2-Amino-6-azidohexanoic acid hydrochloride	5mg	106-Eur	Jena Bio
bs-0103P	Peptides: TGF- Beta1 (Ttansforming Growth Factor – Beta1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CLK-AA006-100	Amino acids or its derivatives: 4-Azido-D-homoalanine HCl, 100 mg pack (R)-2-Amino-4-azidobutanoic acid hydrochloride	100mg	392-Eur	Jena Bio
CLK-AA006-5	Amino acids or its derivatives: 4-Azido-D-homoalanine HCl, 5 mg pack (R)-2-Amino-4-azidobutanoic acid hydrochloride	5mg	106-Eur	Jena Bio
bs-1209P	Peptides: GRK2_BARK1 (G-protein coupled receptor kinase 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1509P	Peptides: BMPR-1A(Bone Morphogenetic protein Receptor-1A) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0099P	Peptides: TGF- Beta3 (Ttansforming Growth Factor – Beta3) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0168P	Peptides: GFRA4 ( Persephin receptor ) (GFR receptor alpha 4) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CLK-AA010-500	Amino acids or its derivatives: 6-Azido-D-lysine HCl, 500 mg pack (R)-2-Amino-6-azidohexanoic acid hydrochloride	500mg	899-Eur	Jena Bio
CLK-AA004-10	Amino acids or its derivatives: 3-Azido-D-alanine HCl, 10 mg pack (R)-2-Amino-3-azidopropanoic acid hydrochloride	10mg	146-Eur	Jena Bio
bs-0850P	Peptides: S-100A1 (S100 calcium-binding protein A1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1912P	Peptides: Alpha-HCG(Human chorionic gonadotropin Alpha ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0664P	Peptides: HMGB1 (High Mobility Group Box protein 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0662P	Peptides: BCRP_ABCG2(breast cancer resistance protein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0023P	Peptides: GSK-3 Beta(NT) (Glycogen Synthase Kinase-3 Beta) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
SMC-358D	Kv1.1 Extracellular, S36-15 Monoclonals AntibodiesS36-15 Synthetic peptide amino acids 191-208 (ELKDDKDFTGTIHRIDNTC, extracellular domain) or rat Kv1.1	100ug	324-Eur	Stressmarq
SMC-360D	Kv2.1 (extracellular), S39-25 Monoclonals AntibodiesS39-25 Synthetic peptide amino acids 11-229 (LPELQSLDEFGQSTDNPQL, extracellular S1-S2 loop) of rat Kv2.1	100ug	324-Eur	Stressmarq
bs-0661P	Peptides: LRP_MVP (Lung resistance related protein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0344P	Peptides: H5N1-M2(Avian influenza Matrix Protein-2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1765P	Peptides: FAST kinase(Fas-activated serine_threonine kinase) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1063P	Peptides: ADRB3_ Beta3-AR ( Beta3-adrenergic receptor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0784P	Peptides: IFN- Beta (Interferon Beta)Anti-mouse,rat Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0039P	Peptides: ADNP (NAP) (Activity-dependent Neuroprotective protein ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1752P	Peptides: EAAT3(Excitatory amino acid transporters 3) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1809P	Peptides: Camk1g(Calcium_calmodulin dependent protein kinase IG) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1662P	Peptides: rHBeAg(Hepatitis B Virus E Antigen protein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1031P	Peptides: IFITM1 (interferon induced transmembrane protein 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0984P	Peptides: LH_CG Receptor(Luteinizing Hormone_Choriogonadotropin Receptor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
SMC-192D	DUX4, P2B1 Monoclonals AntibodiesP2B1 C-terminal 76 amino acids of DUX4 with glutathione-s-transferase (gst) tag	100ug	324-Eur	Stressmarq
bs-2454P	Peptides: MIP-3 beta_ELC_CCL19(Macrophage Inflammatory Protein 3 Beta) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
B366	*Yeast Nitrogen Base w_o Amino Acids USE For investigating carbon and nitrogen requirements of yeasts.	Qty per Litre of Medium: 6,7	2-Eur	biomarkt	yeast
bs-0445P	Peptides: IL1RAPL1 (Interleukin 1 receptor accessory protein-like 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0504P	Proteins: rh-BMP-7_BMP7(bone morphogenetic protein-7,BMP-7;rhBMP-7) Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-2149P	Peptides: Shadow_SPRN(Shadow of prion protein precursor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0387P	Proteins: rh-TNF-Alpha(rh-Tumor Necrosis Factor alpha) Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-0928P	Peptides: phospho-HP1_heterochromatin protein 1 (pTyr24)(fruit fly) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0930P	Peptides: phospho-heterochromatin protein 1 (pTyr41)peptide Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2100P	Peptides: EPEC_E.coli(enteropathogenic E．coli，EPEC) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0749P	Peptides: Kiss-1(Metastasis-suppressor KiSS-1 precursor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2485P	Peptides: phospho JAK2(phospho-Tyr1007+Tyr1008) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1487P	Proteins: CC16(Clara cell protein 16) peptide Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
bs-0738P	Peptides: Livin (Inhibitors of apoptosis proterins Livin) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2091P	Peptides: GSK-3 Alpha (Glycogen Synthase Kinase-3 alpha) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0953P	Peptides: Beta-HCG (Human chorionic gonadotropin Beta) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
orb80760	Terlipressin protein Terlipressin contains 12 amino acids Gly-Gly-Gly-c[Cys-Tyr-Phe-Gln-Asn-Cys]-Pro-Lys-Gly-NH2 and having molecular weight of 1227.4 Dalton. For research use only.	50 mg	408-Eur	Biorb
bs-1790P	Peptides: CRMP2_Dpysl2(collapsin response mediator protein-2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CLK-AA003-500	Amino acids or its derivatives: 3-Azido-L-alanine HCl, 500 mg pack (S)-2-Amino-3-azidopropanoic acid hydrochloride	500mg	899-Eur	Jena Bio
CLK-AA003-10	Amino acids or its derivatives: 3-Azido-L-alanine HCl, 10 mg pack (S)-2-Amino-3-azidopropanoic acid hydrochloride	10mg	146-Eur	Jena Bio
bs-1203P	Peptides: TOPO II Alpha_DNA TP II Alpha (DNA topoisomerase II Alpha) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1539P	Peptides: CD46_MCP(membrane cofactor protein)rat, mouse Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1205P	Peptides: ROCK2 (Rho-associated coiled-coil containing protein kinase 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0066P	Peptides: TGF-Alpha (Ttansforming Growth Factor –Alpha) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CLK-AA003-100	Amino acids or its derivatives: 3-Azido-L-alanine HCl, 100 mg pack (S)-2-Amino-3-azidopropanoic acid hydrochloride	100mg	392-Eur	Jena Bio
CLK-AA003-5	Amino acids or its derivatives: 3-Azido-L-alanine HCl, 5 mg pack (S)-2-Amino-3-azidopropanoic acid hydrochloride	5mg	106-Eur	Jena Bio
bs-0298P	Peptides: Immunoglobuin binding protein-1(CD79A)IGBP-1 Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1534P	Peptides: MAP1LC3A(microtubule-associated protein 1 light chain 3) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0078P	Peptides: TNF-Alpha(Tumor Necrosis Factor-Alpha) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1166P	Peptides: ROCK1 (Rho-associated coiled-coil containing protein kinase 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0322P	Peptides: AEBP1 (Adipocyte enhance binding protein 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-850-612Q	Nucleic acids: 5-Propargylamino-ddCTP - ATTO-612Q	80	746-Eur	Jena Bio
NU-850-647N	Nucleic acids: 5-Propargylamino-ddCTP - ATTO-647N	80	746-Eur	Jena Bio
NU-850-580Q	Nucleic acids: 5-Propargylamino-ddCTP - ATTO-580Q	80	746-Eur	Jena Bio
NU-833-647N	Nucleic acids: gamma-[6-Aminohexyl]-ATP - ATTO-647N	20	209-Eur	Jena Bio
bs-0419P	Peptides: Tau protein Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-833-RHO12	Nucleic acids: gamma-[6-Aminohexyl]-ATP - ATTO-Rho12	80	746-Eur	Jena Bio
NU-833-RHO11	Nucleic acids: gamma-[6-Aminohexyl]-ATP - ATTO-Rho11	80	746-Eur	Jena Bio
NU-850-RHO12	Nucleic acids: 5-Propargylamino-ddCTP - ATTO-Rho12	80	746-Eur	Jena Bio
NU-833-RHO101	Nucleic acids: gamma-[6-Aminohexyl]-ATP - ATTO-Rho101	80	746-Eur	Jena Bio
NU-850-RHO11	Nucleic acids: 5-Propargylamino-ddCTP - ATTO-Rho11	80	746-Eur	Jena Bio
bs-0722P	Peptides: Ki-67 peptides Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0723P	Peptides: P63 protein Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-929-1	Nucleic acids: 2'MeSe-AppNHp, 1 mg pack (2'MeSe-AMPPNP)	1mg	376-Eur	Jena Bio
NU-833-612Q	Nucleic acids: gamma-[6-Aminohexyl]-ATP - ATTO-612Q	80	746-Eur	Jena Bio
NU-850-540Q	Nucleic acids: 5-Propargylamino-ddCTP - ATTO-540Q	80	746-Eur	Jena Bio
NU-833-580Q	Nucleic acids: gamma-[6-Aminohexyl]-ATP - ATTO-580Q	80	746-Eur	Jena Bio
NU-832-665	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - ATTO-665	800	746-Eur	Jena Bio
NU-832-680	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - ATTO-680	80	746-Eur	Jena Bio
NU-832-700	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - ATTO-700	80	746-Eur	Jena Bio
NU-832-660Q	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - DYQ-660	80	746-Eur	Jena Bio
NU-832-725	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - ATTO-725	80	746-Eur	Jena Bio
NU-832-740	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - ATTO-740	80	746-Eur	Jena Bio
bs-0883P	Peptides: GST-Tag protein Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-832-MB2	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - ATTO-MB2	40	746-Eur	Jena Bio
NU-832-MNT	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - MANT	200	746-Eur	Jena Bio
PH-2	Peptides: Protein G_FITC Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-834-580Q	Nucleic acids: gamma-[6-Aminohexyl]-GTP - ATTO-580Q	80	746-Eur	Jena Bio
bs-1346P	Peptides: P73 protein Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-832-TXR	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - Texas Red	160	746-Eur	Jena Bio
NU-851-565	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - ATTO-565	120	746-Eur	Jena Bio
NU-832-TAM	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - 5_6-TAMRA	160	746-Eur	Jena Bio
NU-833-540Q	Nucleic acids: gamma-[6-Aminohexyl]-ATP - ATTO-540Q	80	746-Eur	Jena Bio
NU-832-661Q	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - DYQ-661	80	746-Eur	Jena Bio
NU-850-RHO13	Nucleic acids: 5-Propargylamino-ddCTP - ATTO-Rho13	80	746-Eur	Jena Bio
NU-851-590	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - ATTO-590	120	746-Eur	Jena Bio
NU-851-656	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - OYSTER-656	80	746-Eur	Jena Bio
NU-851-5	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP, 5 mg pack	5mg	316-Eur	Jena Bio
NU-851-660Q	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - DYQ-660	40	746-Eur	Jena Bio
NU-834-RHO12	Nucleic acids: gamma-[6-Aminohexyl]-GTP - ATTO-Rho12	80	746-Eur	Jena Bio
NU-834-RHO11	Nucleic acids: gamma-[6-Aminohexyl]-GTP - ATTO-Rho11	80	746-Eur	Jena Bio
NU-834-RHO101	Nucleic acids: gamma-[6-Aminohexyl]-GTP - ATTO-Rho101	80	746-Eur	Jena Bio
NU-851-661Q	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - DYQ-661	40	746-Eur	Jena Bio
NU-851-495	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - ATTO-495	120	746-Eur	Jena Bio
NU-851-665	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - ATTO-665	800	746-Eur	Jena Bio
NU-850-RHO101	Nucleic acids: 5-Propargylamino-ddCTP - ATTO-Rho101	80	746-Eur	Jena Bio
NU-851-633	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - ATTO-633	80	746-Eur	Jena Bio
NU-851-620	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - ATTO-620	80	746-Eur	Jena Bio
NU-835-485XL	Nucleic acids: N6-(6-Amino)hexyl-dATP - DY-485XL	40	746-Eur	Jena Bio
NU-835-480XL	Nucleic acids: N6-(6-Amino)hexyl-dATP - DY-480XL	40	746-Eur	Jena Bio
NU-851-594	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - ATTO-594	80	746-Eur	Jena Bio
NU-851-550	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - ATTO-550	120	746-Eur	Jena Bio
NU-851-532	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - ATTO-532	120	746-Eur	Jena Bio
NU-834-THIO12	Nucleic acids: gamma-[6-Aminohexyl]-GTP - ATTO-Thio12	80	746-Eur	Jena Bio
NU-834-RHO6G	Nucleic acids: gamma-[6-Aminohexyl]-GTP - ATTO-Rho6G	80	746-Eur	Jena Bio
NU-834-RHO14	Nucleic acids: gamma-[6-Aminohexyl]-GTP - ATTO-Rho14	80	746-Eur	Jena Bio
NU-834-RHO13	Nucleic acids: gamma-[6-Aminohexyl]-GTP - ATTO-Rho13	80	746-Eur	Jena Bio
NU-851-680	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - ATTO-680	80	746-Eur	Jena Bio
NU-851-700	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - ATTO-700	80	746-Eur	Jena Bio
NU-851-390	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - ATTO-390	120	746-Eur	Jena Bio
NU-851-1	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP, 1 mg pack	1mg	128-Eur	Jena Bio
NU-833-THIO12	Nucleic acids: gamma-[6-Aminohexyl]-ATP - ATTO-Thio12	800	746-Eur	Jena Bio
NU-850-THIO12	Nucleic acids: 5-Propargylamino-ddCTP - ATTO-Thio12	80	746-Eur	Jena Bio
NU-850-RHO6G	Nucleic acids: 5-Propargylamino-ddCTP - ATTO-Rho6G	80	746-Eur	Jena Bio
NU-833-RHO6G	Nucleic acids: gamma-[6-Aminohexyl]-ATP - ATTO-Rho6G	80	746-Eur	Jena Bio
NU-833-RHO14	Nucleic acids: gamma-[6-Aminohexyl]-ATP - ATTO-Rho14	80	746-Eur	Jena Bio
NU-833-RHO13	Nucleic acids: gamma-[6-Aminohexyl]-ATP - ATTO-Rho13	80	746-Eur	Jena Bio
NU-851-655	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - ATTO-655	80	746-Eur	Jena Bio
NU-851-TXR	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - Texas Red	160	746-Eur	Jena Bio
NU-851-TAM	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - 5_6-TAMRA	160	746-Eur	Jena Bio
NU-851-425	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - ATTO-425	120	746-Eur	Jena Bio
NU-834-647N	Nucleic acids: gamma-[6-Aminohexyl]-GTP - ATTO-647N	80	746-Eur	Jena Bio
NU-834-612Q	Nucleic acids: gamma-[6-Aminohexyl]-GTP - ATTO-612Q	80	746-Eur	Jena Bio
NU-851-725	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - ATTO-725	80	746-Eur	Jena Bio
NU-851-740	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - ATTO-740	80	746-Eur	Jena Bio
NU-851-488	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - ATTO-488	120	746-Eur	Jena Bio
NU-851-MNT	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - MANT	200	746-Eur	Jena Bio
NU-834-540Q	Nucleic acids: gamma-[6-Aminohexyl]-GTP - ATTO-540Q	80	746-Eur	Jena Bio
NU-851-465	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - ATTO-465	120	746-Eur	Jena Bio
bs-0237P	Peptides: 14-3-3 protein Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-850-RHO14	Nucleic acids: 5-Propargylamino-ddCTP - ATTO-Rho14	80	746-Eur	Jena Bio
NU-803-RHO11	Nucleic acids: Aminoallyl-dUTP - ATTO-Rho11	40	746-Eur	Jena Bio
NU-810-580Q	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - ATTO-580Q	40	746-Eur	Jena Bio
NU-1609-540Q	Nucleic acids: EDA-ATPgammaS - ATTO-540Q	50	1714-Eur	Jena Bio
NU-1609-612Q	Nucleic acids: EDA-ATPgammaS - ATTO-612Q	50	1714-Eur	Jena Bio
NU-1609-647N	Nucleic acids: EDA-ATPgammaS - ATTO-647N	50	1714-Eur	Jena Bio
NU-803-540Q	Nucleic acids: Aminoallyl-dUTP - ATTO-540Q	40	746-Eur	Jena Bio
NU-1609-RHO101	Nucleic acids: EDA-ATPgammaS - ATTO-Rho101	50	1714-Eur	Jena Bio
NU-1609-RHO11	Nucleic acids: EDA-ATPgammaS - ATTO-Rho11	50	1714-Eur	Jena Bio
NU-1609-RHO12	Nucleic acids: EDA-ATPgammaS - ATTO-Rho12	50	1714-Eur	Jena Bio
NU-1609-RHO13	Nucleic acids: EDA-ATPgammaS - ATTO-Rho13	50	1714-Eur	Jena Bio
NU-1609-RHO6G	Nucleic acids: EDA-ATPgammaS - ATTO-Rho6G	50	1714-Eur	Jena Bio
NU-1609-THIO12	Nucleic acids: EDA-ATPgammaS - ATTO-Thio12	50	1714-Eur	Jena Bio
NU-810-540Q	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - ATTO-540Q	40	746-Eur	Jena Bio
CSB-100	SiMax™ PCR Products_Agarose Gel Purification Nucleic Acids Isolation & Purification	100 preps	139-Eur	SBS
NU-1610-540Q	Nucleic acids: EDA-GTPgammaS - ATTO-540Q	50	1714-Eur	Jena Bio
NU-830S	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP, S pack	50Units	128-Eur	Jena Bio
NU-810-612Q	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - ATTO-612Q	40	746-Eur	Jena Bio
NU-810-647N	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - ATTO-647N	10	209-Eur	Jena Bio
NU-806S	Nucleic acids: 8-[(4-Amino)butyl]-amino-ATP, S pack	50Units	128-Eur	Jena Bio
NU-1609-580Q	Nucleic acids: EDA-ATPgammaS - ATTO-580Q	50	1714-Eur	Jena Bio
NU-803-RHO101	Nucleic acids: Aminoallyl-dUTP - ATTO-Rho101	40	746-Eur	Jena Bio
NU-806L	Nucleic acids: 8-[(4-Amino)butyl]-amino-ATP, L pack	250Units	316-Eur	Jena Bio
NU-810-THIO12	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - ATTO-Thio12	40	746-Eur	Jena Bio
NU-810-RHO6G	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - ATTO-Rho6G	40	746-Eur	Jena Bio
DNJ3001	DnaJ(Amino acids 1-376), E.coli, Recombinant, E.coli	0.5mg	478-Eur	ATGen
NU-810-RHO14	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - ATTO-Rho14	40	746-Eur	Jena Bio
NU-810-RHO13	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - ATTO-Rho13	40	746-Eur	Jena Bio
NU-806-MNT	Nucleic acids: 8-[(4-Amino)butyl]-amino-ATP - MANT (MABA-ATP)	50	209-Eur	Jena Bio
NU-810-RHO12	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - ATTO-Rho12	40	746-Eur	Jena Bio
NU-803-647N	Nucleic acids: Aminoallyl-dUTP - ATTO-647N	10	209-Eur	Jena Bio
NU-810-RHO11	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - ATTO-Rho11	40	746-Eur	Jena Bio
NU-803-612Q	Nucleic acids: Aminoallyl-dUTP - ATTO-612Q	40	746-Eur	Jena Bio
NU-803-580Q	Nucleic acids: Aminoallyl-dUTP - ATTO-580Q	40	746-Eur	Jena Bio
NU-810-RHO101	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - ATTO-Rho101	40	746-Eur	Jena Bio
NU-1610-580Q	Nucleic acids: EDA-GTPgammaS - ATTO-580Q	50	1714-Eur	Jena Bio
NU-809-RHO6G	Nucleic acids: 5-Propargylamino-dCTP - ATTO-Rho6G	40	746-Eur	Jena Bio
NU-809-647N	Nucleic acids: 5-Propargylamino-dCTP - ATTO-647N	10	209-Eur	Jena Bio
NU-809-612Q	Nucleic acids: 5-Propargylamino-dCTP - ATTO-612Q	40	746-Eur	Jena Bio
NU-809-580Q	Nucleic acids: 5-Propargylamino-dCTP - ATTO-580Q	40	746-Eur	Jena Bio
NU-807-BIO	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - Biotin, pack	50	172-Eur	Jena Bio
NU-821-BIOXX	Nucleic acids: Biotin-18-UTP, pack Biotin-XX-5-Aminoallyl-UTP	60	172-Eur	Jena Bio
NU-809-540Q	Nucleic acids: 5-Propargylamino-dCTP - ATTO-540Q	40	746-Eur	Jena Bio
NU-821-BIOX	Nucleic acids: Biotin-11-UTP, pack Biotin-X-5-Aminoallyl-UTP	60	172-Eur	Jena Bio
NU-821-BIO16	Nucleic acids: Biotin-16-UTP, pack Biotin-16-5-aminoallyl-UTP	60	172-Eur	Jena Bio
NU-807L	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP, L pack	250Units	316-Eur	Jena Bio
NU-829-BIO	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - Biotin, pack	50	172-Eur	Jena Bio
NU-1619-480XL	Nucleic acids: 5-Propargylamino-ddUTP - DY-480XL	80	746-Eur	Jena Bio
NU-807-MNT	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - MANT (MAHA-ATP)	200	746-Eur	Jena Bio
NU-1619-485XL	Nucleic acids: 5-Propargylamino-ddUTP - DY-485XL	80	746-Eur	Jena Bio
NU-807S	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP, S pack	50Units	128-Eur	Jena Bio
NU-829L	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP, L pack	500Units	316-Eur	Jena Bio
NU-809-RHO101	Nucleic acids: 5-Propargylamino-dCTP - ATTO-Rho101	40	746-Eur	Jena Bio
NU-809-RHO11	Nucleic acids: 5-Propargylamino-dCTP - ATTO-Rho11	40	746-Eur	Jena Bio
NU-812-JOE	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - 6-JOE	160	746-Eur	Jena Bio
NU-830L	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP, L pack	250Units	316-Eur	Jena Bio
NU-1610-612Q	Nucleic acids: EDA-GTPgammaS - ATTO-612Q	50	1714-Eur	Jena Bio
NU-1610-647N	Nucleic acids: EDA-GTPgammaS - ATTO-647N	50	1714-Eur	Jena Bio
NU-1610-RHO101	Nucleic acids: EDA-GTPgammaS - ATTO-Rho101	50	1714-Eur	Jena Bio
NU-1610-RHO11	Nucleic acids: EDA-GTPgammaS - ATTO-Rho11	50	1714-Eur	Jena Bio
NU-1610-RHO12	Nucleic acids: EDA-GTPgammaS - ATTO-Rho12	50	1714-Eur	Jena Bio
NU-830-BIO	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - Biotin, pack	50	172-Eur	Jena Bio
NU-1610-RHO13	Nucleic acids: EDA-GTPgammaS - ATTO-Rho13	50	1714-Eur	Jena Bio
NU-1610-RHO14	Nucleic acids: EDA-GTPgammaS - ATTO-Rho14	50	1714-Eur	Jena Bio
bs-0362P	Proteins: Protein A Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
NU-809-RHO14	Nucleic acids: 5-Propargylamino-dCTP - ATTO-Rho14	40	746-Eur	Jena Bio
NU-1610-RHO6G	Nucleic acids: EDA-GTPgammaS - ATTO-Rho6G	50	1714-Eur	Jena Bio
NU-809-RHO13	Nucleic acids: 5-Propargylamino-dCTP - ATTO-Rho13	40	746-Eur	Jena Bio
NU-1610-THIO12	Nucleic acids: EDA-GTPgammaS - ATTO-Thio12	50	1714-Eur	Jena Bio
NU-809-RHO12	Nucleic acids: 5-Propargylamino-dCTP - ATTO-Rho12	40	746-Eur	Jena Bio
NU-829S	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP, S pack	100Units	128-Eur	Jena Bio
NU-803-RHO12	Nucleic acids: Aminoallyl-dUTP - ATTO-Rho12	40	746-Eur	Jena Bio
NU-832-656	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - OYSTER-656	80	746-Eur	Jena Bio
NU-832-488	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - ATTO-488	120	746-Eur	Jena Bio
NU-805-647N	Nucleic acids: N6-(6-Amino)hexyl-ATP - ATTO-647N	20	209-Eur	Jena Bio
NU-812-5FM	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - 5-FAM	160	746-Eur	Jena Bio
NU-1103L	Nucleic acids: Etheno-ATP (epsilon-ATP), L pack (1,N6-Etheno-ATP)	2500Units	166-Eur	Jena Bio
NU-832-465	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - ATTO-465	120	746-Eur	Jena Bio
NU-832-425	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - ATTO-425	120	746-Eur	Jena Bio
NU-832-390	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - ATTO-390	120	746-Eur	Jena Bio
NU-1103S	Nucleic acids: Etheno-ATP (epsilon-ATP), S pack (1,N6-Etheno-ATP)	500Units	76-Eur	Jena Bio
NU-1140L	Nucleic acids: Etheno-ADP (epsilon-ADP), L pack (1,N6-Etheno-ADP)	2500Units	389-Eur	Jena Bio
NU-1140S	Nucleic acids: Etheno-ADP (epsilon-ADP), S pack (1,N6-Etheno-ADP)	500Units	128-Eur	Jena Bio
NU-811-ROX	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - 6-ROX	160	746-Eur	Jena Bio
NU-1141L	Nucleic acids: Etheno-AMP (epsilon-AMP), L pack (1,N6-Etheno-AMP)	2500Units	139-Eur	Jena Bio
NU-1141S	Nucleic acids: Etheno-AMP (epsilon-AMP), S pack (1,N6-Etheno-AMP)	500Units	66-Eur	Jena Bio
NU-811-5FM	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - 5-FAM	160	746-Eur	Jena Bio
NU-805-612Q	Nucleic acids: N6-(6-Amino)hexyl-ATP - ATTO-612Q	80	746-Eur	Jena Bio
NU-832-495	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - ATTO-495	120	746-Eur	Jena Bio
NU-805-580Q	Nucleic acids: N6-(6-Amino)hexyl-ATP - ATTO-580Q	80	746-Eur	Jena Bio
NU-832-532	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - ATTO-532	120	746-Eur	Jena Bio
NU-832-655	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - ATTO-655	80	746-Eur	Jena Bio
bs-0157P	Peptides: Tau protein Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-805-540Q	Nucleic acids: N6-(6-Amino)hexyl-ATP - ATTO-540Q	80	746-Eur	Jena Bio
NU-832-620	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - ATTO-620	80	746-Eur	Jena Bio
NU-812-ROX	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - 6-ROX	160	746-Eur	Jena Bio
NU-832-594	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - ATTO-594	80	746-Eur	Jena Bio
NU-812-CY5	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - Cy5	160	746-Eur	Jena Bio
NU-812-CY3	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - Cy3	160	746-Eur	Jena Bio
NU-832-590	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - ATTO-590	120	746-Eur	Jena Bio
NU-812-776	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - DY-776	40	746-Eur	Jena Bio
NU-832-633	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - ATTO-633	80	746-Eur	Jena Bio
NU-812-751	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - DY-751	40	746-Eur	Jena Bio
NU-812-6FM	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - 6-FAM	160	746-Eur	Jena Bio
NU-832-565	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - ATTO-565	120	746-Eur	Jena Bio
NU-832-550	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - ATTO-550	120	746-Eur	Jena Bio
NU-811-JOE	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - 6-JOE	160	746-Eur	Jena Bio
NU-805-RHO101	Nucleic acids: N6-(6-Amino)hexyl-ATP - ATTO-Rho101	80	746-Eur	Jena Bio
NU-809-THIO12	Nucleic acids: 5-Propargylamino-dCTP - ATTO-Thio12	40	746-Eur	Jena Bio
NU-831-BIOX	Nucleic acids: Biotin-11-CTP, pack Biotin-X-5-Propargylamino-CTP	60	172-Eur	Jena Bio
NU-811-CY3	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - Cy3	160	746-Eur	Jena Bio
NU-803-RHO13	Nucleic acids: Aminoallyl-dUTP - ATTO-Rho13	40	746-Eur	Jena Bio
NU-811-776	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - DY-776	40	746-Eur	Jena Bio
NU-805-RHO13	Nucleic acids: N6-(6-Amino)hexyl-ATP - ATTO-Rho13	80	746-Eur	Jena Bio
NU-803-RHO14	Nucleic acids: Aminoallyl-dUTP - ATTO-Rho14	40	746-Eur	Jena Bio
NU-811-6FM	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - 6-FAM	160	746-Eur	Jena Bio
NU-831-BIOXX	Nucleic acids: Biotin-18-CTP, pack Biotin-XX-5-Propargylamino-CTP	60	172-Eur	Jena Bio
NU-803-RHO6G	Nucleic acids: Aminoallyl-dUTP - ATTO-Rho6G	40	746-Eur	Jena Bio
NU-811-751	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - DY-751	40	746-Eur	Jena Bio
NU-803-THIO12	Nucleic acids: Aminoallyl-dUTP - ATTO-Thio12	40	746-Eur	Jena Bio
DNJ3001	DnaJ(Amino acids 1-376), E.coli, Recombinant, E.coli	100ug	226-Eur	ATGen
NU-805-RHO11	Nucleic acids: N6-(6-Amino)hexyl-ATP - ATTO-Rho11	80	746-Eur	Jena Bio
NU-811-CY5	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - Cy5	160	746-Eur	Jena Bio
NU-805-RHO12	Nucleic acids: N6-(6-Amino)hexyl-ATP - ATTO-Rho12	80	746-Eur	Jena Bio
NU-1609-RHO14	Nucleic acids: EDA-ATPgammaS - ATTO-Rho14	50	1714-Eur	Jena Bio
NU-805-THIO12	Nucleic acids: N6-(6-Amino)hexyl-ATP - ATTO-Thio12	80	746-Eur	Jena Bio
NU-805-RHO14	Nucleic acids: N6-(6-Amino)hexyl-ATP - ATTO-Rho14	80	746-Eur	Jena Bio
NU-805-RHO6G	Nucleic acids: N6-(6-Amino)hexyl-ATP - ATTO-Rho6G	80	746-Eur	Jena Bio
orb81448	Human Thioredoxin-2 protein MTRX Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 108 amino acids and having a molecular mass of 11 kDa. For research use only.	5	154-Eur	Biorb	recombinant
SMC-131C	HO-1 Antibody Monoclonal, Clone number: 1F12-A6 Host: Mouse, Isotype: IgG1 Kappa Immunogen: Human HO-1 synthetic peptide, amino acids 1-30	25ug	148-Eur	Stressmarq
29-028	LSR has a probable role in the clearance of triglyceride-rich lipoprotein from blood. It binds chylomicrons, LDL and VLDL in presence of free fatty acids and allows their subsequent uptake in the cell	0.05 mg	632-Eur	Prosci
28-360	ZNF271 may be involved in transcriptional regulation. It plays a role in the EBV-mediated transformation processZinc finger proteins interact with nucleic acids and have diverse functions. The zinc fi	0.1 mg	496-Eur	Prosci	Proteins
25-901	SLC16A6 is a proton-linked monocarboxylate transporter.It catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived	0.05 mg	632-Eur	Prosci	cat
27-770	LSR has a probable role in the clearance of triglyceride-rich lipoprotein from blood. It binds chylomicrons, LDL and VLDL in presence of free fatty acids and allows their subsequent uptake in the cell	0.05 mg	632-Eur	Prosci
SMC-366D	CASK Antibody Monoclonal, Clone number: S56A-50 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 318-415 of rat CASK_Lin2	100ug	279-Eur	Stressmarq
orb81191	Human Leukocyte-Associated Ig-Like Receptor 1 protein LAIR1 Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing amino acids 105 and having a molecular mass of 11.	5	154-Eur	Biorb	recombinant
SMC-367D	Kv4.2 Antibody Monoclonal, Clone number: S57-1 Host: Mouse, Isotype: IgG1 Immunogen: Synthetic peptide amino acids 209-225 (extracellular S1-S2 loop) of rat Kv4.2 (CGSSPGHIKELPSGERY	100ug	279-Eur	Stressmarq
orb81492	Human Dnak (HSP70) His tag protein HSP 70kD produced in E.coli is a single,non-glycosylated polypeptide chain containing 661 amino acids fused to His-tag at N-terminus and having total Mw of 72.2 kDa.	10	154-Eur	Biorb	recombinant
orb90170	Firefly Luciferin 4-monooxygenase protein Luciferase produced in E.coli is a single, non-glycosylated polypeptide chain containing 571 amino acids (1-550 a.a.) and having a molecular mass of 62.9kDa.L	5	154-Eur	Biorb	recombinant
SMC-356D	PSD95 Antibody Monoclonal, Clone number: S28-43 Host: Mouse, Isotype: IgG2a Immunogen: Fusion protein amino acids 77-200 of human PSD95_SAP90	100ug	279-Eur	Stressmarq
SMC-355D	Kv1.1 Antibody Monoclonal, Clone number: S20-78 Host: Mouse, Isotype: IgG1 Immunogen: Synthetic peptide amino acids 458-476 (cytoplasmic C-terminus) of rat Kv1.1 (EEDMNNSIAHYRQANIRTG)	100ug	279-Eur	Stressmarq
SMC-384D	BK Beta4, S18A-3 Monoclonals AntibodiesS18A-3 Fusion protein amino acids 45-167 (entire extracellular domain) of mouse BKBeta4, accession number NP_067427.	100ug	324-Eur	Stressmarq
SMC-357D	MAGUK (pan) Antibody Monoclonal, Clone number: S28-86 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein Amino acids 77-299 of human PSD95_Sap90	100ug	279-Eur	Stressmarq
MA1055	Monoclonal Anti-MAP Kinase, Activated (Diphosphorylated ERK-1&2), Clone number: IL-13, Ig type: mouse IgG1, Immunogen: A synthetic peptide containing 11 amino acids, HTGFLTpEYpVAT, corresponding to th	100μg/vial	232-Eur	Bouster Immunoleader
orb82654	Canine IL3 protein Recombinant Dog Interleukin-3 is a single non-glycosylated polypeptide chain containing 120 amino acids. IL-3 is a hematopoietic growth factor that promotes the survival, differenti	1 mg	2635-Eur	Biorb	recombinant
29-925	SLC16A8 is proton-linked monocarboxylate transporter. It catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived f	0.1 mg	496-Eur	Prosci	cat
orb80035	Canine GCSF protein GMCSF k9 Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 128 amino acids and having a molecular mass of 14.2 kDa. GM-CSF is purified by p	5	154-Eur	Biorb	recombinant
SMC-131D	HO-1 Antibody Monoclonal, Clone number: 1F12-A6 Host: Mouse, Isotype: IgG1 Kappa Immunogen: Human HO-1 synthetic peptide, amino acids 1-30	100ug	283-Eur	Stressmarq
SMC-374D	Co-Rest_RCOR1, S72-8 Monoclonals AntibodiesS72-8 Fusion protein amino acids 109-293 of human Co-Rest, accession number NP_055971. Includes ELM2 and SANT domains.	100ug	324-Eur	Stressmarq
SMC-184C	HIF1 alpha Antibody Monoclonal, Clone number: ESEE122 Host: Mouse, Isotype: IgG1 Immunogen: Recombinant fragment corresponding to amino acids 329-530	25ug	116-Eur	Stressmarq
SMC-184D	HIF1 alpha Antibody Monoclonal, Clone number: ESEE122 Host: Mouse, Isotype: IgG1 Immunogen: Recombinant fragment corresponding to amino acids 329-530	100ug	252-Eur	Stressmarq
orb82827	IL6 protein Recombinant Rat IL6 is a single, non-glycosylated polypeptide chain containing 187 amino acids. IL6 is a pleiotropic cytokine that plays an important role in host defense by regulating imm	250	2799-Eur	Biorb	recombinant
orb81476	Human WNT Inhibitory Factor 1 protein WIF1 produced in Hi-5 cells is a single, glycosylated polypeptide chain containing 369 amino acids (29-379 a.a.) and having a molecular mass of 40.5 kDa, (48kDa o	2	277-Eur	Biorb	human
29-912	SLC7A1 is a high-affinity, low capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine) in non-hepatic tissues. It may also function as an ecotropic ret	0.05 mg	632-Eur	Prosci	tissue
bs-1116P	Peptides: AMPK Beta1 (AMP-activated Protein Kinase beta-1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0064P	Peptides: Substance P Receptor (Neurokinin receptor1;Tachykinin receptor1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1112P	Peptides: GPC3(glypican 3; Intestinal protein OCI-5; GTR2-2; MXR7) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1108P	Peptides: IGFBP-2 (Insulin-like Growth Factor Binding Protein 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0564P	Peptides: CaMK2a(calcium_calmodulin-dependent protein kinase II alpha) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0541P	Peptides: CaMK2b(calcium_calmodulin-dependent protein kinase II beita) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1609P	Peptides: SATB1(special AT-rich sequence binding protein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
HSP06035	HSP70 (amino acids 1_641) Human, Recombinant, His_ tagged, E.coli Source Recombinant	1 mg	1459-Eur	Assaypro	recombinant
bs-1133P	Peptides: SPARC (secreted protein acidic and rich in cysteine) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
orb82826	IL10 protein Recombinant Rat IL10 is a single, glycosylated polypeptide chain containing 160 amino acids. For research use only.	1 mg	2799-Eur	Biorb	recombinant
bs-1402P	Peptides: SREBP-1(Sterol Regulatory Element Binding Protein-1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0035P	Peptides: CREB-1 (cAMP responsive element binding protein-1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0329P	Peptides: TRA16 (Testicular orphan nuclear receptor-4 (TR4)-associated protein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1501P	Peptides: Rarres2_TIG2_Chemerin(Retinoic acid receptor responder protein 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0385P	Peptides: Ag-ARC(ARG3.1_ARC, Activity-regulated cytoskeleton-associated protein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1162P	Peptides: MIP2 (myocardial ischemic preconditioning upregulated protein 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0328P	Peptides: TRA16 (Testicular orphan nuclear receptor-4 (TR4)-associated protein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
orb60036	Felypressin Felypressin(Octapressin) is a Vasopressin 1 agonist and a peptide containing eight amino acids including cystine. For research use only.	10 mg	388-Eur	Biorb
bs-1152P	Peptides: ATP1b2_Na+K+ ATPase(ATPase, Na+_K+ transporting, beta 2 polypeptide) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1335P	Peptides: Notch1_MOTC(Neurogenic locus notch homolog protein 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
orb60048	Splenopentin Splenopentin is an immunomodulatory pentapeptide which corresponds to the amino acids 32-36 of the splenic hormone splenin. For research use only.	25 mg	364-Eur	Biorb
bs-1020P	Peptides: MAPK1_ERK3 (Mitogen-activated protein kinase 3; P44MAPK) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0788P	Peptides: Fabp2 (fatty acid binding protein 2, intestinal) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0824P	Peptides: LFABP_FABP-1(Liver Fatty acid binding protein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CSB-E08771m	Mouse free fatty acids,FFA ELISA Kit, Species Mouse, Sample Type serum, plasma	96T	981-Eur	Cusabio	elisa
CSB-E16977Rb	Rabbit Free Fatty Acids(FFA) ELISA Kit, Species Rabbit, Sample Type serum, plasma	96T	913-Eur	Cusabio	elisa
SMC-315D	TrpC4, S77-15 Monoclonals AntibodiesS77-15 Synthetic peptide amino acids 930-947 of rat TrpC4, accession number O35119	100ug	324-Eur	Stressmarq
bs-0863P	Peptides: GRO Alpha_GRO_MGSA_CXCL1 protein (growth regulated oncogene Alpha) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2155P	Peptides: HER2 receptor(NT)(erbB-2 isoform 2 receptor N-Terminus) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2156P	Peptides: HER2 receptor(NT)(erbB-2 isoform 2 receptor N-Terminus) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0897P	Peptides: LFABP_FABP-2(Liver Fatty acid binding protein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0898P	Peptides: IFABP(Intestinal Fatty acid binding protein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
SMC-305D	HCN2, S71-37 Monoclonals AntibodiesS71-37 Fusion protein amino acids 761-863 of rat HCN2, accession number Q9JKA9	100ug	324-Eur	Stressmarq
SMC-363D	SH3GL1, S51-1 Monoclonals AntibodiesS51-1 Synthetic peptide amino acids 287-302 od rat SH3GL1, accession number AAH70893.	100ug	324-Eur	Stressmarq
bs-0728P	Peptides: HCV-HCBP1_ACY-3(Hepatitis C virus core-binding protein 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NAL03-100ML	Buffers and Supplements,Non-Essential Amino Acids Solution,100X solution. Sterile filtered	100ml	58-Eur	Caisson Laboratory
bs-0791P	Peptides: CGRP (calcitonin gene related peptide, CGRP) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0211P	Peptides: shank1(SH3 and multiple anleyrin repead domins protein 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0457P	Peptides: phosphor-SMAD(p-Ser425)、phosphor-Mothers against decapentaplegic Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0808P	Peptides: HCMV UL49(Human Cytomegalovirus UL49 Gene) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2086P	Peptides: ompF(putative outer membrane porin F protein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CSB-E08769h	Human free fatty acids,FFA ELISA Kit, Species Human, Sample Type serum, plasma	96T	913-Eur	Cusabio	elisa
SMC-134C	SAP102 Monoclonals AntibodiesS19-2 Fusion protein amino acids 1-120 ofd rat SAP102 (accession number Q62936)	25ug	147-Eur	Stressmarq
SMC-134D	SAP102 Monoclonals AntibodiesS19-2 Fusion protein amino acids 1-120 ofd rat SAP102 (accession number Q62936)	100ug	268-Eur	Stressmarq
SMC-332D	CAVBETA2 , S8b-1 Monoclonals AntibodiesS8B-1 Synthetic peptide amino acids 189-205 of rat CavBeta2, accession numer NP_446303	100ug	324-Eur	Stressmarq
SPC-165C	PUMA (NT) Antibody Polyclonal Host: Rabbit Immunogen: N-terminal amino acids of human PUMA	25ug	143-Eur	Stressmarq
NU-1009L	Nucleic acids: dNTP Bundle incl. dUTP, L pack 4x 100 mM (dATP, dCTP, dGTP, dUTP)	4 x 1ml	194-Eur	Jena Bio
bs-1642P	Peptides: phospho-FAK(pSer732)(phospho-Focal adhesion kinase) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
SMC-385D	PICK1, S20-8 Monoclonals AntibodiesS20-8 Fusion protein amino acids 101-30 of rat PICK1, accession number AAG48152	100ug	324-Eur	Stressmarq
SPC-200D	TLR4 Polyclonals Ab, Host Rabbit Developed against a synthetic peptide corresponding to amino acids 420-435 of human TLR4.	100ug	296-Eur	Stressmarq
NU-1020S	Nucleic acids: dNTP Mix incl. dUTP _ 10 mM, S pack Premix of 10 mM dATP, dCTP, dGTP and 20 mM dUTP	200	50-Eur	Jena Bio
bs-0318P	Peptides: PADI4 (HL-60 PAD)(Protein-arginine deiminase type IV，PADI 4，PAD I4 ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-1020L	Nucleic acids: dNTP Mix incl. dUTP _ 10 mM, L pack Premix of 10 mM dATP, dCTP, dGTP and 20 mM dUTP	1ml	110-Eur	Jena Bio
NU-1009S	Nucleic acids: dNTP Bundle incl. dUTP, S pack 4x 100 mM (dATP, dCTP, dGTP, dUTP)	4 x 200	71-Eur	Jena Bio
HSP06032	HSP70 (amino acids 1_641) Human, Recombinant, His_ tagged, E.coli Source Recombinant	0.2 mg	436-Eur	Assaypro	recombinant
bs-0992P	Peptides: HPV16-E7_E7 protein(Human papillomavirus type 16) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
orb81538	Borrelia p41 protein The E.coli derived recombinant protein contains the p41 immunodominant regions, 158-296 amino acids. For research use only.	100	228-Eur	Biorb	elisa
SMC-336D	SHANK3, S69-46 Monoclonals AntibodiesS69-46 Synthetic peptide amino acids 840-857 of rat Shank3, accession number Q9JLU4	100ug	324-Eur	Stressmarq
LIP	Lipolysis Assay KIT, Dual Glycerol and free fatty acids Detection, Omental Cells (REAGENTS + CELLS), 100	kit	1473-Eur	ZenBio	elisa
SMC-333D	NR2B glutamate receptor, S59-20 Monoclonals AntibodiesS59-20 Fusion protein amino acids 20-271 (N-terminus) of rat NR2B	100ug	324-Eur	Stressmarq
SPC-165D	PUMA (NT) Antibody Polyclonal Host: Rabbit Immunogen: N-terminal amino acids of human PUMA	100ug	279-Eur	Stressmarq
bs-0990P	Peptides: HPV16-E6_E6 protein(Human papillomavirus type 16) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
SMC-373D	Nav1.2, S69-3 Monoclonals AntibodiesS69-3 Fusion protein amino acids 1882-2005 (cytoplasmic C-terminus) of rat Nav1.2	100ug	324-Eur	Stressmarq
SMC-319D	TrpV3, S15-4 Monoclonals AntibodiesS15-4 Synthetic peptdie amino acids 458-474 (C-terminus) of rat TrpV3, accession number NP_001020928	100ug	324-Eur	Stressmarq
bs-0406P	Peptides: IGFBP-5 ( Insulin-like Growth Factor Binding Protein 5、IBP5) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0766P	Peptides: CD4(Rabbit Anti-Human Mouse rat CD4 Palyclonal Anti-body) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
SMC-304D	HCN1, S70-28 Monoclonals AntibodiesS70-28 Fusion protein amino acids 778-910 (C terminus) of rat HCN1, accession number Q9JKBO	100ug	324-Eur	Stressmarq
bs-2104P	Peptides: TNFAIP1(Tumor necrosis factor-alpha-induced protein 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
SMC-408D	Clcn3 Protein, S258-5 Monoclonals AntibodiesS258-5 Synthetic peptide amino acids 98-115 (cytoplasmic N-terminus) of rat Clcn3	100ug	324-Eur	Stressmarq
SMC-410D	NR1 Glutamate Receptor Protein, S308-48 Monoclonals AntibodiesS308-48 Fusion protein amino acids 42-361 (extracellular N-terminus) of rat NR1	100ug	324-Eur	Stressmarq
SMC-311D	KIR2.2, S124B-38 Monoclonals AntibodiesS124B-38 Fusion protein amino acids 362-427 of rat Kir2.2, accession number NP_446433	100ug	324-Eur	Stressmarq
bs-0132P	Peptides: SARS putative orflab polyprotein (SARS coronavirus CUHK-W1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
SMC-309D	KCNQ4, S43-6 Monoclonals AntibodiesS43-6 Fusion protein amino acids 2-77 of human KCNQ4, accession number P56696	100ug	324-Eur	Stressmarq
orb81755	Epstein-Barr Virus (HHV-4) p23 protein The E.coli derived recombinant protein contains the HHV-4 p23 regions, 1-162 amino acids. For research use only.	100	228-Eur	Biorb	recombinant
orb81698	HIV-I p24 gag protein The E.coli derived 39 kDa recombinant protein is non-glycosylated polypeptide chain, containing the HIV-1 p24 gag immunodominant regions, 77-436 amino acids.The HIV-1 p24 gag is	100	228-Eur	Biorb	recombinant
SMC-312D	KIR2.3, S25-35 Monoclonals AntibodiesS25-35 Fusion protein amino acids 390-445 of human Kir2.3, accession number NP_032453	100ug	324-Eur	Stressmarq
SMC-301D	Cav1.3, S48A-9 Monoclonals AntibodiesS48A-9 Fusion protein amino acids 859-875 of rat Cav1.3, accession numbr P27732	100ug	324-Eur	Stressmarq
bs-2427P	Peptides: SCN9A_NAV1.7(Sodium channel protein type 9 subunit alpha) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
SMC-400D	Anti-Ankyrin B Protein, S105-13 Monoclonals AntibodiesS105_13 Synthetic peptide amino acids 203-496 of human Ankyrin-B	100ug	324-Eur	Stressmarq
bs-1434P	Peptides: IGFBP-3 (Insulin-like Growth Factor Binding Protein 3)C-term Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
orb60055	Hgh fragment 176-191 Hgh fragment 176-191 is a modified form of amino acids 176-191 at the C-terminal region of the human growth hormone (hGH). For research use only.	5 mg	203-Eur	Biorb	human
bs-0896P	Peptides: HCMV UL23_HHV5 UL23(Human Cytomegalovirus UL23 Gene) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
Y-0208	Peptides: GHRP-6 Acetate peptide(Growth hormone-releasing peptides 6) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
orb81631	Hepatitis A Virus VP4-VP2 protein The E.coli derived 44 kDa recombinant protein contains the VP4-VP2 immunodominant regions, amino acids 55-164. For research use only.	100	228-Eur	Biorb	recombinant
orb81630	Hepatitis A Virus VP3 protein The E.coli derived 38 kDa recombinant protein contains the VP3 immunodominant regions, amino acids 304-415. For research use only.	100	228-Eur	Biorb	recombinant
orb82732	Human IL6 protein Recombinant Human Interleukin 6 is a single, non-glycosylated polypeptide chain containing 184 amino acids. For research use only.	1 mg	2079-Eur	Biorb	recombinant
bs-1312P	Peptides: IGF-IIBP3(Insulin like growth factor 2 mRNA binding protein 3) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
orb81623	Hepatitis A Virus VP1 protein The E.coli derived 48 kDa recombinant protein contains the VP1 immunodominant regions, amino acids 502-605. For research use only.	100	228-Eur	Biorb	recombinant
bs-0530P	Peptides: PPAR Gamma (peroxisome proliferator-activated receptor-gamma) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
Y-0207	Peptides: GHRP-2 Acetate peptide(Growth hormone-releasing peptides 2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
orb81625	Hepatitis A Virus VP1-P2A (669-782) protein The E.coli derived recombinant protein contains the VP1-P2A immunodominant regions, amino acids 669-782. For research use only.	100	228-Eur	Biorb	recombinant
orb81624	Hepatitis A Virus VP1-P2A (722-830) protein The E.coli derived 51.2 kDa recombinant protein contains the VP1-P2A immunodominant regions, amino acids 722-830. For research use only.	100	228-Eur	Biorb	recombinant
orb82734	Human IL8 protein Recombinant Human Interleukin-8 (IL8) is a single, non-glycosylated polypeptide chain containing 77 amino acids. For research use only.	1 mg	2079-Eur	Biorb	recombinant
orb90161	L-Asparaginase protein L-Asparaginase produced from E.coli containing 303 amino acids and having a molecular mass of 31731 Dalton. For research use only.	500 IU	154-Eur	Biorb	recombinant
NU-809-485XL	Nucleic acids: 5-Propargylamino-dCTP - DY-485XL	40	746-Eur	Jena Bio
NU-809-480XL	Nucleic acids: 5-Propargylamino-dCTP - DY-480XL	10	209-Eur	Jena Bio
NU-807-TAM	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - 5_6-TAMRA	160	746-Eur	Jena Bio
NU-807-425	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - ATTO-425	120	746-Eur	Jena Bio
NU-821-FAMX	Nucleic acids: Fluorescein-12-UTP Fluorescein-X-5-Aminoallyl-UTP	30	209-Eur	Jena Bio
NU-807-740	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - ATTO-740	80	746-Eur	Jena Bio
NU-824-RHO11	Nucleic acids: EDA-m7GTP - ATTO-Rho11	40	746-Eur	Jena Bio
NU-821-BIO	Nucleic acids: Biotin-4-UTP, pack Biotin-5-Aminoallyl-UTP	60	172-Eur	Jena Bio
NU-824-RHO101	Nucleic acids: EDA-m7GTP - ATTO-Rho101	40	746-Eur	Jena Bio
NU-821-THIO12	Nucleic acids: Aminoallyl-UTP - ATTO-Thio12	40	746-Eur	Jena Bio
NU-821-540Q	Nucleic acids: Aminoallyl-UTP - ATTO-540Q	40	746-Eur	Jena Bio
NU-821-580Q	Nucleic acids: Aminoallyl-UTP - ATTO-580Q	40	746-Eur	Jena Bio
NU-807-594	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - ATTO-594	80	746-Eur	Jena Bio
NU-821-612Q	Nucleic acids: Aminoallyl-UTP - ATTO-612Q	40	746-Eur	Jena Bio
NU-807-TXR	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - Texas Red	160	746-Eur	Jena Bio
NU-821-647N	Nucleic acids: Aminoallyl-UTP - ATTO-647N	10	209-Eur	Jena Bio
NU-807-725	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - ATTO-725	80	746-Eur	Jena Bio
NU-807-MB2	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - ATTO-MB2	40	746-Eur	Jena Bio
NU-821-RHO101	Nucleic acids: Aminoallyl-UTP - ATTO-Rho101	40	746-Eur	Jena Bio
NU-821-RHO11	Nucleic acids: Aminoallyl-UTP - ATTO-Rho11	40	746-Eur	Jena Bio
NU-807-532	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - ATTO-532	120	746-Eur	Jena Bio
NU-807-550	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - ATTO-550	30	209-Eur	Jena Bio
NU-824-612Q	Nucleic acids: EDA-m7GTP - ATTO-612Q	40	746-Eur	Jena Bio
NU-807-565	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - ATTO-565	30	209-Eur	Jena Bio
NU-807-590	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - ATTO-590	120	746-Eur	Jena Bio
NU-824-580Q	Nucleic acids: EDA-m7GTP - ATTO-580Q	40	746-Eur	Jena Bio
NU-807-620	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - ATTO-620	80	746-Eur	Jena Bio
NU-807-633	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - ATTO-633	80	746-Eur	Jena Bio
NU-807-655	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - ATTO-655	80	746-Eur	Jena Bio
NU-810-485XL	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - DY-485XL	40	746-Eur	Jena Bio
NU-810-480XL	Nucleic acids: EDA-AppNHp (EDA-AMPPNP) - DY-480XL	40	746-Eur	Jena Bio
NU-824-540Q	Nucleic acids: EDA-m7GTP - ATTO-540Q	40	746-Eur	Jena Bio
NU-807-495	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - ATTO-495	120	746-Eur	Jena Bio
NU-807-656	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - OYSTER-656	80	746-Eur	Jena Bio
NU-807-488	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - ATTO-488	30	209-Eur	Jena Bio
NU-821-RHO12	Nucleic acids: Aminoallyl-UTP - ATTO-Rho12	40	746-Eur	Jena Bio
NU-821-RHO13	Nucleic acids: Aminoallyl-UTP - ATTO-Rho13	40	746-Eur	Jena Bio
NU-821-RHO14	Nucleic acids: Aminoallyl-UTP - ATTO-Rho14	40	746-Eur	Jena Bio
NU-821-RHO6G	Nucleic acids: Aminoallyl-UTP - ATTO-Rho6G	40	746-Eur	Jena Bio
NU-807-700	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - ATTO-700	80	746-Eur	Jena Bio
NU-807-390	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - ATTO-390	120	746-Eur	Jena Bio
NU-807-680	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - ATTO-680	80	746-Eur	Jena Bio
NU-807-665	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - ATTO-665	800	746-Eur	Jena Bio
NU-824-647N	Nucleic acids: EDA-m7GTP - ATTO-647N	10	209-Eur	Jena Bio
NU-807-465	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - ATTO-465	120	746-Eur	Jena Bio
NU-807-661Q	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - DYQ-661	80	746-Eur	Jena Bio
NU-807-660Q	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - DYQ-660	80	746-Eur	Jena Bio
NU-1610-485XL	Nucleic acids: EDA-GTPgammaS - DY-485XL	50	1714-Eur	Jena Bio
NU-824-RHO12	Nucleic acids: EDA-m7GTP - ATTO-Rho12	40	746-Eur	Jena Bio
NU-850-480XL	Nucleic acids: 5-Propargylamino-ddCTP - DY-480XL	80	746-Eur	Jena Bio
NU-830-594	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - ATTO-594	80	746-Eur	Jena Bio
NU-830-620	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - ATTO-620	80	746-Eur	Jena Bio
NU-830-633	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - ATTO-633	80	746-Eur	Jena Bio
NU-830-655	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - ATTO-655	80	746-Eur	Jena Bio
NU-830-656	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - OYSTER-656	80	746-Eur	Jena Bio
NU-830-660Q	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - DYQ-660	80	746-Eur	Jena Bio
NU-830-661Q	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - DYQ-661	80	746-Eur	Jena Bio
NU-830-665	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - ATTO-665	800	746-Eur	Jena Bio
NU-830-680	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - ATTO-680	20	209-Eur	Jena Bio
NU-830-700	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - ATTO-700	80	746-Eur	Jena Bio
NU-830-725	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - ATTO-725	80	746-Eur	Jena Bio
NU-830-740	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - ATTO-740	80	746-Eur	Jena Bio
NU-830-590	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - ATTO-590	120	746-Eur	Jena Bio
NU-830-565	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - ATTO-565	120	746-Eur	Jena Bio
NU-830-550	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - ATTO-550	120	746-Eur	Jena Bio
NU-829-700	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - ATTO-700	80	746-Eur	Jena Bio
NU-829-725	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - ATTO-725	80	746-Eur	Jena Bio
NU-829-740	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - ATTO-740	80	746-Eur	Jena Bio
NU-829-MB2	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - ATTO-MB2	40	746-Eur	Jena Bio
NU-829-MNT	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - MANT	200	746-Eur	Jena Bio
NU-829-TAM	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - 5_6-TAMRA	160	746-Eur	Jena Bio
NU-829-TXR	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - Texas Red	160	746-Eur	Jena Bio
NU-830-390	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - ATTO-390	120	746-Eur	Jena Bio
NU-830-425	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - ATTO-425	120	746-Eur	Jena Bio
NU-830-465	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - ATTO-465	120	746-Eur	Jena Bio
NU-830-488	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - ATTO-488	240	746-Eur	Jena Bio
NU-830-532	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - ATTO-532	120	746-Eur	Jena Bio
NU-830-MB2	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - ATTO-MB2	40	746-Eur	Jena Bio
NU-830-MNT	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - MANT	200	746-Eur	Jena Bio
NU-831-RHO13	Nucleic acids: 5-Propargylamino-CTP - ATTO-Rho13	40	746-Eur	Jena Bio
NU-831-RHO14	Nucleic acids: 5-Propargylamino-CTP - ATTO-Rho14	40	746-Eur	Jena Bio
NU-831-RHO6G	Nucleic acids: 5-Propargylamino-CTP - ATTO-Rho6G	40	746-Eur	Jena Bio
NU-831-THIO12	Nucleic acids: 5-Propargylamino-CTP - ATTO-Thio12	40	746-Eur	Jena Bio
NU-833-485XL	Nucleic acids: gamma-[6-Aminohexyl]-ATP - DY-485XL	80	746-Eur	Jena Bio
NU-833-480XL	Nucleic acids: gamma-[6-Aminohexyl]-ATP - DY-480XL	80	746-Eur	Jena Bio
NU-832-ROX	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - 6-ROX	160	746-Eur	Jena Bio
NU-832-JOE	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - 6-JOE	160	746-Eur	Jena Bio
NU-832-CY5	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - Cy5	160	746-Eur	Jena Bio
NU-832-CY3	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - Cy3	160	746-Eur	Jena Bio
NU-832-776	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - DY-776	80	746-Eur	Jena Bio
NU-832-751	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - DY-751	80	746-Eur	Jena Bio
NU-831-RHO11	Nucleic acids: 5-Propargylamino-CTP - ATTO-Rho11	40	746-Eur	Jena Bio
NU-831-RHO101	Nucleic acids: 5-Propargylamino-CTP - ATTO-Rho101	40	746-Eur	Jena Bio
NU-831-BIO	Nucleic acids: Biotin-4-CTP, pack Biotin-5-Propargylamino-CTP	60	172-Eur	Jena Bio
NU-830-TAM	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - 5_6-TAMRA	160	746-Eur	Jena Bio
NU-830-TXR	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - Texas Red	160	746-Eur	Jena Bio
NU-1610-480XL	Nucleic acids: EDA-GTPgammaS - DY-480XL	50	1714-Eur	Jena Bio
NU-1609-485XL	Nucleic acids: EDA-ATPgammaS - DY-485XL	50	1714-Eur	Jena Bio
NU-1609-480XL	Nucleic acids: EDA-ATPgammaS - DY-480XL	50	1714-Eur	Jena Bio
NU-831-540Q	Nucleic acids: 5-Propargylamino-CTP - ATTO-540Q	40	746-Eur	Jena Bio
NU-831-580Q	Nucleic acids: 5-Propargylamino-CTP - ATTO-580Q	40	746-Eur	Jena Bio
NU-834-485XL	Nucleic acids: gamma-[6-Aminohexyl]-GTP - DY-485XL	80	746-Eur	Jena Bio
NU-834-480XL	Nucleic acids: gamma-[6-Aminohexyl]-GTP - DY-480XL	80	746-Eur	Jena Bio
NU-832-6FM	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - 6-FAM	160	746-Eur	Jena Bio
NU-831-612Q	Nucleic acids: 5-Propargylamino-CTP - ATTO-612Q	40	746-Eur	Jena Bio
NU-831-647N	Nucleic acids: 5-Propargylamino-CTP - ATTO-647N	40	746-Eur	Jena Bio
NU-832-5FM	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - 5-FAM	160	746-Eur	Jena Bio
NU-827-RHO11	Nucleic acids: EDA-m7GDP - ATTO-Rho11	40	746-Eur	Jena Bio
NU-829-495	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - ATTO-495	120	746-Eur	Jena Bio
NU-827-647N	Nucleic acids: EDA-m7GDP - ATTO-647N	40	746-Eur	Jena Bio
NU-829-532	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - ATTO-532	120	746-Eur	Jena Bio
NU-829-550	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - ATTO-550	120	746-Eur	Jena Bio
NU-829-565	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - ATTO-565	120	746-Eur	Jena Bio
NU-827-612Q	Nucleic acids: EDA-m7GDP - ATTO-612Q	40	746-Eur	Jena Bio
NU-851-CY3	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - Cy3	160	746-Eur	Jena Bio
NU-827-580Q	Nucleic acids: EDA-m7GDP - ATTO-580Q	40	746-Eur	Jena Bio
NU-827-540Q	Nucleic acids: EDA-m7GDP - ATTO-540Q	40	746-Eur	Jena Bio
NU-851-6FM	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - 6-FAM	160	746-Eur	Jena Bio
NU-829-488	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - ATTO-488	120	746-Eur	Jena Bio
NU-829-465	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - ATTO-465	120	746-Eur	Jena Bio
NU-829-425	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - ATTO-425	120	746-Eur	Jena Bio
NU-827-RHO101	Nucleic acids: EDA-m7GDP - ATTO-Rho101	40	746-Eur	Jena Bio
NU-831-RHO12	Nucleic acids: 5-Propargylamino-CTP - ATTO-Rho12	40	746-Eur	Jena Bio
NU-851-5FM	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - 5-FAM	160	746-Eur	Jena Bio
NU-827-RHO13	Nucleic acids: EDA-m7GDP - ATTO-Rho13	40	746-Eur	Jena Bio
NU-827-RHO14	Nucleic acids: EDA-m7GDP - ATTO-Rho14	40	746-Eur	Jena Bio
NU-827-RHO6G	Nucleic acids: EDA-m7GDP - ATTO-Rho6G	40	746-Eur	Jena Bio
NU-827-THIO12	Nucleic acids: EDA-m7GDP - ATTO-Thio12	40	746-Eur	Jena Bio
NU-803-485XL	Nucleic acids: Aminoallyl-dUTP - DY-485XL	40	746-Eur	Jena Bio
NU-803-480XL	Nucleic acids: Aminoallyl-dUTP - DY-480XL	40	746-Eur	Jena Bio
NU-829-390	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - ATTO-390	120	746-Eur	Jena Bio
NU-851-751	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - DY-751	80	746-Eur	Jena Bio
NU-829-590	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - ATTO-590	120	746-Eur	Jena Bio
NU-850-485XL	Nucleic acids: 5-Propargylamino-ddCTP - DY-485XL	80	746-Eur	Jena Bio
NU-824-THIO12	Nucleic acids: EDA-m7GTP - ATTO-Thio12	40	746-Eur	Jena Bio
NU-829-660Q	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - DYQ-660	80	746-Eur	Jena Bio
NU-829-661Q	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - DYQ-661	80	746-Eur	Jena Bio
NU-805-480XL	Nucleic acids: N6-(6-Amino)hexyl-ATP - DY-480XL	80	746-Eur	Jena Bio
NU-824-RHO6G	Nucleic acids: EDA-m7GTP - ATTO-Rho6G	40	746-Eur	Jena Bio
NU-824-RHO14	Nucleic acids: EDA-m7GTP - ATTO-Rho14	40	746-Eur	Jena Bio
NU-805-485XL	Nucleic acids: N6-(6-Amino)hexyl-ATP - DY-485XL	80	746-Eur	Jena Bio
NU-824-RHO13	Nucleic acids: EDA-m7GTP - ATTO-Rho13	40	746-Eur	Jena Bio
NU-851-ROX	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - 6-ROX	160	746-Eur	Jena Bio
NU-829-665	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - ATTO-665	800	746-Eur	Jena Bio
NU-829-680	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - ATTO-680	80	746-Eur	Jena Bio
NU-827-RHO12	Nucleic acids: EDA-m7GDP - ATTO-Rho12	40	746-Eur	Jena Bio
NU-851-CY5	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - Cy5	160	746-Eur	Jena Bio
NU-851-JOE	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - 6-JOE	160	746-Eur	Jena Bio
NU-829-620	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - ATTO-620	80	746-Eur	Jena Bio
NU-829-633	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - ATTO-633	80	746-Eur	Jena Bio
NU-829-655	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - ATTO-655	80	746-Eur	Jena Bio
NU-829-594	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - ATTO-594	80	746-Eur	Jena Bio
NU-851-776	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - DY-776	80	746-Eur	Jena Bio
NU-829-656	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - OYSTER-656	80	746-Eur	Jena Bio
NU-830-495	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - ATTO-495	120	746-Eur	Jena Bio
SMC-371D	KChiP3 Antibody Monoclonal, Clone number: S66-38 Host: Mouse, Isotype: IgG2a Immunogen: Fusion protein amino acids 1-256 (Full lenght) of rat Calsenillin_DREAM_KChIP3	100ug	279-Eur	Stressmarq
SMC-365D	KChiP (Pan) Antibody Monoclonal, Clone number: S55-82 Host: Mouse, Isotype: IgG2a Immunogen: Fusion protein amino acids 1-216 (full length) of rat KChIP1b	100ug	279-Eur	Stressmarq
SMC-368D	KChiP2 Antibody Monoclonal, Clone number: S60-73 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 1-252 (Full lenght) of rat KChIP2b	100ug	279-Eur	Stressmarq
orb81083	Human Eukaryotic Translation Initiation Factor 5A protein EIF5A produced in E.coli is a single, non-glycosylated polypeptide chain containing 154 amino acids and having a molecular mass of 16.8 kDa. E	5	154-Eur	Biorb	recombinant
SMC-364D	KChiP1 Antibody Monoclonal, Clone number: S55-7 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 1-216 (Full lenght) of rat KChIPIb	100ug	279-Eur	Stressmarq
SMC-353D	KvBeta2 Antibody Monoclonal, Clone number: S17-70 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 1-367 (full length) of rat Kvβ2	100ug	279-Eur	Stressmarq
orb80374	Human GCSF His tag protein GMCSF Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 127 amino acids fragment (18-144) and having a molecular mass of 18.98kDa wi	5	154-Eur	Biorb	recombinant
SMC-361D	KvBeta (Pan) Antibody Monoclonal, Clone number: S40-17 Host: Mouse, Isotype: IgG2a Immunogen: Fusion protein amino acids 1-401 (full length) of rat Kvβ1	100ug	279-Eur	Stressmarq
orb80980	Human Chromosome Open Reading Frame 108 protein C6ORF108 produced in E.coli is a single, non-glycosylated polypeptide chain containing 194 amino acids (1-174 a.a.) and having a molecular mass of 21.2k	5	154-Eur	Biorb	recombinant
orb80315	Rat FGF 9 protein Rat FGF9 Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 205 amino acids and having a molecular mass of 23308 Dalton.The FGF-9 Mouse Recomb	2	154-Eur	Biorb	recombinant
SMC-410D	GluN1-NR1 Antibody Monoclonal, Clone number: S308-48 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 42-361 (extracellular N-terminus) of rat NR1	100ug	279-Eur	Stressmarq
orb90207	Human Pterin-4-Alpha-Carbinolamine Dehydratase protein PCBD1 produced in E.coli is a single, non-glycosylated polypeptide chain containing 124 amino acids (1-104 a.a.) and having a molecular mass of 1	5	154-Eur	Biorb	recombinant
orb81455	Human Urinary Trypsin Inhibitor (UTI) protein Recombinant Ulinastatin produced in Yeast is a single, glycosylated, polypeptide having 143 amino acids, molecular mass of 20 kDa and predicted pI of 4.5.	20	154-Eur	Biorb	recombinant
orb80033	Rat GCSF protein Granulocyte MCSF Rat Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 128 amino acids and having a molecular mass of 14590.65 Dalton. GM-CSF	5	154-Eur	Biorb	recombinant
orb80405	Rat IL1 alpha protein IL1A Rat Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 155amino acids and having a molecular mass of 17703 Dalton. The IL-1A is purif	2	154-Eur	Biorb	recombinant
SMC-387D	Kv1.3 Antibody Monoclonal, Clone number: S23-27 Host: Mouse, Isotype: IgG2a Immunogen: Synthetic peptide amino acids 485- 506 (Cytoplasmic Cterminus) of rat Kv1.3 (GGMNHSAFPQTPFKTGNSYATC), accession n	100ug	279-Eur	Stressmarq
orb90209	Human Phosphodiesterase 6D cGMP-Specific Rod Delta protein PDE6D produced in E.coli is a single, non-glycosylated polypeptide chain containing 158 amino acids (1-150 a.a.) and having a molecular mass	5	154-Eur	Biorb	recombinant
orb80133	Rat MIP2 protein GRO-Beta Rat Recombinant also caled Rat MIP-2 produced in E.coli is a single, non-glycosylated, polypeptide chain containing 73 amino acids and having a molecular mass of 7923 Dalton.	2	154-Eur	Biorb	recombinant
29-918	SLCO1A2 is a sodium-independent transporter which mediates cellular uptake of organic ions in the liver. Its substrates include bile acids, bromosulphophthalein, and some steroidal compounds. The prot	0.05 mg	632-Eur	Prosci	rat
SPC-200D	TLR4 Antibody Polyclonal Host: Rabbit Immunogen: Developed against a synthetic peptide corresponding to amino acids 420-435 of human TLR4.	100ug	252-Eur	Stressmarq
30-140	Kynureninase is a pyridoxal-5'-phosphate (pyridoxal-P) dependent enzyme that catalyzes the cleavage of L-kynurenine and L-3-hydroxykynurenine into anthranilic and 3-hydroxyanthranilic acids, respectiv	0.1 mg	496-Eur	Prosci	cat
30-141	Kynureninase is a pyridoxal-5'-phosphate (pyridoxal-P) dependent enzyme that catalyzes the cleavage of L-kynurenine and L-3-hydroxykynurenine into anthranilic and 3-hydroxyanthranilic acids, respectiv	0.05 mg	632-Eur	Prosci	cat
SMC-393D	VAChT Vesicular Acetylcholine Transporter Protein, S6-38 Monoclonals AntibodiesS6_38 Synthetic peptide amino acids 521-532 of human VACht	100ug	324-Eur	Stressmarq
SMC-337D	NR2B, S59-36 Monoclonals AntibodiesS59-36 Fusion protein amino acids 20-271 (extracellular N-terminus) of rat NR2B, acession number QOO960	100ug	324-Eur	Stressmarq
SMC-307D	KCNQ1, S37A-10 Monoclonals AntibodiesS37A-10 Fusion protein amino acids 2-101 of human KCNQ1, accession number P51787	100ug	324-Eur	Stressmarq
orb82675	Human CXCL10 protein Recombinant Human CXCL10_IP-10 is a single, non-glycosylated polypeptide chain containing 77 amino acids. For research use only.	1 mg	2079-Eur	Biorb	recombinant
orb80285	Human BNP protein BNP Peptide Human is polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. For research use only.	10 mg	408-Eur	Biorb	human
bs-1124P	Peptides: 5-HTR1A (5-HT1A (5-hydroxytryptamine_serotonin receptor 1A; 5HT1a; ADRBRL1; ADRB2RL1; HTR1A) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
orb81668	Varicella Zoster Virus gE protein The E.coli derived recombinant protein contains the VZV gE immunodominant regions, amino acids 48-135. For research use only.	100	228-Eur	Biorb	recombinant
orb81674	Toxoplasma Gondii P30 (SAG 1) protein The E.coli derived recombinant protein contains the p30 (SAG1) immunodominant regions, amino acids 45-198. For research use only.	100	228-Eur	Biorb	recombinant
orb81673	Toxoplasma Gondii P29 (GRA 7) protein The E.coli derived recombinant protein contains the p29 (GRA7) immunodominant regions, amino acids 24-100. For research use only.	100	228-Eur	Biorb	recombinant
orb81672	Toxoplasma Gondii P24 (GRA 1) protein The E.coli derived recombinant protein contains the p24 (GRA1) immunodominant regions, amino acids 57-149. For research use only.	100	228-Eur	Biorb	recombinant
SMC-386D	GluR2, S21-32 Monoclonals AntibodiesS21-32 Fusion protein amino acids 834-883 (cytoplasmic C-terminus) of rat GluR2 accession number P42262.	100ug	324-Eur	Stressmarq
orb81756	Epstein-Barr Virus (HHV-4) p23 His protein The E.coli derived recombinant protein contains the HHV-4 p23 regions, 10- C-end amino acids having Mw of 17.7kDa. For research use only.	100	359-Eur	Biorb	recombinant
SMC-382D	Pancortin, S96-7 Monoclonals AntibodiesS96-7 Synthetic peptide of amino acids 28-48 of human pancortin-1 (SLVGLNTTRLSAASGGTLDRS), accession number Q99784.	100ug	324-Eur	Stressmarq
EIAAB12851	3-keto acyl-CoA synthase ELOVL7,Bos taurus,Bovine,Elongation of very long chain fatty acids protein 7,ELOVL7		1333-Eur	EIAab
SMC-302D	CAV1.3, S38-8 Monoclonals AntibodiesS38-8 Fusion protein amino acids 2025-2161 of rat Cav1.3, accession number P27732	100ug	324-Eur	Stressmarq
orb81752	Epstein-Barr Virus (HHV-4) p18 protein The E.coli derived recombinant mosaic protein contains the HHV-4 p18 regions, 1-119 amino acids. For research use only.	100	228-Eur	Biorb	recombinant
EIAAB12845	3-keto acyl-CoA synthase ELOVL5,Bos taurus,Bovine,Elongation of very long chain fatty acids protein 5,ELOVL5		1333-Eur	EIAab
EIAAB12843	3-keto acyl-CoA synthase Elovl5,Elongation of very long chain fatty acids protein 5,Elovl5,Mouse,Mus musculus		1164-Eur	EIAab
EIAAB12841	3-keto acyl-CoA synthase Elovl4,Elongation of very long chain fatty acids protein 4,Elovl4,Mouse,Mus musculus		1164-Eur	EIAab
SMC-308D	KCNQ2, S26A-23 Monoclonals AntibodiesS26A-23 Fusion protein amino acids 1-59 of human KCNQ2, accession number O43526	100ug	324-Eur	Stressmarq
SMC-341D	DNMT3L, S117-9 Monoclonals AntibodiesS117-9 Fusion protein amino acids 1-387 of human DNMT3L, accession number BAA95556	100ug	324-Eur	Stressmarq
SMC-310D	Kir2.1, S112B-14 Monoclonals AntibodiesS112B-14 Fusion protein amino acids 41-64 and 189-428 of mouse Kir2.1, accession number NP_032451.	100ug	324-Eur	Stressmarq
orb80575	Human CD4 (125-202) protein CD-4 Human Recombinant is fused with 4kDa His Tag and encoding amino acids 125-202, having total molecular weight of 19 kDa. For research use only.	5	154-Eur	Biorb	recombinant
bs-1832P	Peptides: PGC-1 Alpha(peroxisome proliferator-activated receptor- Gamma coactivator 1 Alpha) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
SMC-325D	CHAPSYN-110 (PSD93) MAGUK, S18-30 Monoclonals AntibodiesS18-30 Fusion protein amino acids 1-852 of rat Chapsyn-110; accession number Q63622	100ug	324-Eur	Stressmarq
SMC-329D	SHANK1, S22-21 Monoclonals AntibodiesS22-21 Fusion protein amino acids 469-691 (SH3_PDZ domains) if rat Shank1 (accession number Q9WV48)	100ug	324-Eur	Stressmarq
SMC-334D	TrpV3, S15-39 Monoclonals AntibodiesS15-39 Synthetic peptide amino acids 458-474 (cytoplasmic C-terminus) of rat TrpV3 accession number NP_001020928)	100ug	324-Eur	Stressmarq
orb82690	Human Eotaxin protein Recombinant human CCL11 is a single, non-glycosylated polypeptide chain containing 74 amino acids. For research use only.	1 mg	2079-Eur	Biorb	recombinant
SMC-343D	TrpC7, S64A-36 Monoclonals AntibodiesS64A-36 Synthetic peptide amino acids 845-862 of human TRPC7, accession number Q9HCX4	100ug	324-Eur	Stressmarq
bs-0882P	Peptides: Shiga-like toxin IIe variant subunit A 0139[Escherichia coli 0139] Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
EIAAB12852	3-keto acyl-CoA synthase Elovl7,Elongation of very long chain fatty acids protein 7,Elovl7,Mouse,Mus musculus		1164-Eur	EIAab
orb81541	Herpes Simplex Virus-1 gG protein The E.coli derived recombinant protein contains the HSV-1 gG immunodominant regions, 84-175 amino acids. For research use only.	100	228-Eur	Biorb	recombinant
orb82725	Human IL21 protein Recombinant Human Interleukin-21 is a a single non-glycosylated polypeptide chain containing 132 amino acids. For research use only.	1 mg	2799-Eur	Biorb	recombinant
bs-0354P	Peptides: ZCWCC1(Zinc finger CW-type coiled-coil domain protein 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
BQ 042A-EALD	ENZYMATIC ASSAY KITS (CHEMISTRY AUTOANALYZER), LIVER DISEASES: Total Bile Acids (TBA) (Enzymatic Cycling) Kit	430 tests	483-Eur	Bioquant
orb81692	HIV-1 p24 Core Sf9 protein HIV-1 p24 core Recombinant- derived from HIV-1 gene fragment is 35 kDa gag polyprotein that includes all of the p24 plus additional amino acids of the C-terminus of p17 and	2	154-Eur	Biorb	recombinant
orb81689	HIV-1 nef protein The E.coli derived 20 kDa recombinant protein is non-glycosylated polypeptide chain, containing the HIV-1 nef immunodominant regions, 3-190 amino acids. The HIV-1 nef is fused to bet	100	228-Eur	Biorb	recombinant
bs-2446P	Peptides: phospho-eIF4E(pSer209)(phospho-Eukaryotic translation initiation factor 4E) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
orb81540	Herpes Simplex Virus-1 gD protein The E.coli derived recombinant protein contains the HSV-1 gD immunodominant regions, 266-394 amino acids. For research use only.	100	228-Eur	Biorb	recombinant
orb80677	Human MDC His Tag protein MDC Human Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 90 amino acids (25-93 a.a.) and having a molecular mass of 10.3 kDa. The MDC is fus	5	154-Eur	Biorb	recombinant
SMC-346D	GABAARALPHA1 protein, S95-35 Monoclonals AntibodiesS96-55 Fusion protein amino acids 327-450 of mouse GABA-A-R-Beta1, accession number P50571	100ug	324-Eur	Stressmarq
orb82679	Human CXCL2 protein Recombinant human CXCL2_GRO-beta is a single, non-glycosylated polypeptide chain containing 73 amino acids. For research use only.	1 mg	2079-Eur	Biorb	recombinant
SMC-362D	KvBeta1.2, S47-42 Monoclonals AntibodiesS47-42 Synthetic peptide amino acids 9-28 (ADIPSPKLGLPKSSESALKC, unique N-terminus) of rat KvBeta1.2, accession number NP_003462.	100ug	324-Eur	Stressmarq
orb82733	Human IL8 protein Recombinant Human Interleukin-8 (IL8) produced in E. coli is a single non-glycosylated polypeptide chain containing 72 amino acids. For research use only.	1 mg	2079-Eur	Biorb	recombinant
SMC-375D	Contactin, S73-20 Monoclonals AntibodiesS73-20 Synthetic peptide amino acids 21-37 (D_EFTWHRRYGHGVSEEDKC) extracellular domain of rat contactin, accession number A57112.	100ug	324-Eur	Stressmarq
orb81542	Herpes Simplex Virus-2 gD protein The E.coli derived 39.7 kDa recombinant protein contains the HSV-2 gD immunodominant regions 266-394 amino acids, fused with 26 kDa GST-tag. For research use only.	100	228-Eur	Biorb	recombinant
SMC-342D	NAV1.8 , S134-12 Monoclonals AntibodiesS134-12 Fusion protein amino acids 1724-1956 of rat Nav1.8, accession number Q62968	100ug	324-Eur	Stressmarq
SMC-340D	GABAAR BETA1, S96-55 Monoclonals AntibodiesS96-55 Fusion protein amino acids 327-450 of mouse GABA-A-R-Beta1, accession number P50571	100ug	324-Eur	Stressmarq
SMC-200D	DNMT1 Monoclonals Antibodies60B1220.1 Raised against a synthetic peptide corresponding to amino acids 637-650 of human DNMT1 (Gene accession number NP_001370)	100ug	324-Eur	Stressmarq
SMC-306D	HCN3, S141-28 Monoclonals AntibodiesS141-28 Fusion protein amino acids 660-779 (C terminus) of mouse HCN3, accession number O88705	100ug	324-Eur	Stressmarq
EIAAB12850	3-keto acyl-CoA synthase ELOVL7,Elongation of very long chain fatty acids protein 7,ELOVL7,Homo sapiens,Human		1109-Eur	EIAab
EIAAB12840	3-keto acyl-CoA synthase ELOVL4,Elongation of very long chain fatty acids protein 4,ELOVL4,Homo sapiens,Human		1109-Eur	EIAab
30-149	The catalytic conversion of UTP to CTP is accomplished by the enzyme cytidine-5-prime-triphosphate synthetase. The enzyme is important in the biosynthesis of phospholipids and nucleic acids, and plays	0.1 mg	496-Eur	Prosci	cat
30-148	The catalytic conversion of UTP to CTP is accomplished by the enzyme cytidine-5-prime-triphosphate synthetase. The enzyme is important in the biosynthesis of phospholipids and nucleic acids, and plays	0.1 mg	496-Eur	Prosci	cat
EIAAB12836	3-keto acyl-CoA synthase Elovl2,Elongation of very long chain fatty acids protein 2,Elovl2,Mouse,Mus musculus,Ssc2		1164-Eur	EIAab
EIAAB12835	3-keto acyl-CoA synthase Elovl1,Elongation of very long chain fatty acids protein 1,Elovl1,Mouse,Mus musculus,Ssc1		1164-Eur	EIAab
orb81628	Hepatitis A Virus P2C-P3A protein The E.coli derived recombinant protein contains the P2C-P3A immunodominant regions, amino acids 1392-1521. For research use only.	100	228-Eur	Biorb	recombinant
SMC-320D	HCN4, S141-10 Monoclonals AntibodiesS114-10 Fusion protein amino acids 1-019-1198 (c-terminus) of rat HCN4, accession number Q9JKA7	100ug	324-Eur	Stressmarq
SMC-323D	SLACK potassium channel, S3-26 Monoclonals AntibodiesS3-26 Fusion protein amino acids 1168-1237 of rat Slo2.2 (Slack); NP_068625	100ug	324-Eur	Stressmarq
SMC-339D	GABAAR Beta3, S87-25 Monoclonals AntibodiesS87-25 Fusion protein amino acids 370-433 of mouse GABA-A_r Beta3, accession number AAB60502.	100ug	324-Eur	Stressmarq
SMC-201D	DNMT1 Monoclonals Antibodies Raised against a synthetic peptide corresponding to amino acids 637-650 of human DNMT1 (Gene accession number NP_001370)	100ug	324-Eur	Stressmarq
28-656	LASS4 is a member of LASS family. Members of this family regulate (dihydro)ceramide synthases responsible for production of sphingolipids containing different fatty acids.	0.1 mg	496-Eur	Prosci
orb81629	Hepatitis A Virus P3C protein The E.coli derived 40 kDa recombinant protein contains the P3C immunodominant regions, amino acids 1643-1743. For research use only.	100	228-Eur	Biorb	recombinant
orb81626	Hepatitis A Virus P2C protein The E.coli derived recombinant 38.5 kDa protein contains the P2C immunodominant regions, amino acids 1121-1234. For research use only.	100	228-Eur	Biorb	recombinant
orb81627	Hepatitis A Virus P2C-P3B protein The E.coli derived 53.7 kDa recombinant protein contains the P2C-P3B immunodominant regions, amino acids 1492-1606. For research use only.	100	228-Eur	Biorb	recombinant
SMC-407D	mGluR1_5 Glutamate Receptor Protein, S75-33 Monoclonals AntibodiesS75-33 Fusion protein amino acids 824-1203 (cytoplasmic C-terminus) of rat mGluR5b	100ug	324-Eur	Stressmarq
28-412	LASS4 is a member of LASS family. Members of this family regulate (dihydro)ceramide synthases responsible for production of sphingolipids containing different fatty acids.	0.05 mg	632-Eur	Prosci
orb81353	Rat Secretagogin protein Secretagogin Rat Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 286 amino acids and having a molecular mass of 33.3 kDa. The Rat SC	2	154-Eur	Biorb	recombinant
orb80163	Rat SDF 1 beta protein SDF-1 beta Rat Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 72 amino acids and having a molecular mass of 8.4 kDa. The Rat SDF-1b is purified	2	154-Eur	Biorb	recombinant
orb90311	Human Urokinase protein Urokinase is two-chain glycoprotein containing 411 amino acids with 12 dissulfide bonds. Its molecular weight is 54,000 Dalton. For research use only.	100	170-Eur	Biorb	human
orb81639	Hepatitis D Virus protein The E.coli derived recombinant protein contains the HDV immunodominant regions, amino acids 1-108aa, 151-209aa. For research use only.	100	228-Eur	Biorb	recombinant
29-426	TRNT1 belongs to the tRNA nucleotidyltransferase_poly (A) polymerase family. It adds and repairs the conserved 3'-CCA sequence necessary for the attachment of amino acids to the 3' terminus of tRNA mo	0.1 mg	496-Eur	Prosci	pcr
orb81136	Human Growth Arrest-Specific 7, Isoform b protein GAS7 produced in E.coli is a single, non-glycosylated polypeptide chain containing 436 amino acids (1-416a.a.) and having a molecular mass of 49.8 kDa	10	154-Eur	Biorb	recombinant
orb80047	Rat IGF1 protein Insulin-Like Growth Factor Rat Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 70 amino acids and having a molecular mass of 7687 Dalton. IG	10	154-Eur	Biorb	recombinant
SMC-350D	KvBeta1.1 Antibody Monoclonal, Clone number: S9-40 Host: Mouse, Isotype: IgG2b Immunogen: Synthetic peptide amino acids 7-28 (unique N-terminus) of rat Kvβ1.1 (TEHNLKSPNGEDRLLSKQSST)	100ug	279-Eur	Stressmarq
32-107	AMACR (alpha-methylacyl-CoA racemase) has been recently described as prostate cancer-specific gene that encodes a protein involved in the beta-oxidation of branched chain fatty acids. Expression of AM	0.1 mL	509-Eur	Prosci	recombinant
CSB-EL007624RA	Rat ELOVL family member 6, elongation of long chain fatty acids (FEN1_Elo2, SUR4_Elo3-like, yeast) (ELOVL6) ELISA kit, Species Rat, Sample Type serum, plasma	96T	913-Eur	Cusabio	elisa
orb80398	Gilthead Seabream IGF1 protein Insulin-Like Growth Factor-IGilthead SeabreamRecombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 68 amino acids and having a molec	20	244-Eur	Biorb	recombinant
orb81389	Human Stromal Interaction Molecule 1 protein Recombinant STIM1 produced in E.coli is a single, non-glycosylated polypeptide chain containing 343 amino acids and having a molecular mass of 38 kDa. STIM	5	154-Eur	Biorb	recombinant
orb81501	Human Heat Shock Transcription Factor-1 protein Recombinant HSF1 produced in E.coli is a single, non-glycosylated polypeptide chain containing 549 amino acids and having a molecular mass of 59 kDa.The	5	154-Eur	Biorb	recombinant
SMC-407D	mGluR1_5 Antibody Monoclonal, Clone number: S75-33 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 824-1203 (cytoplasmic C-terminus) of rat mGluR5b	100ug	279-Eur	Stressmarq
orb80932	Human ASF1 Anti-Silencing Function Homolog A protein ASF1A produced in E.coli is a single,non-glycosylated polypeptide chain containing 204 amino acids (1-240 a.a.) and having a molecular mass of 27 k	5	154-Eur	Biorb	recombinant
CSB-EL007623RA	Rat ELOVL family member 5, elongation of long chain fatty acids (FEN1_Elo2, SUR4_Elo3-like, yeast) (ELOVL5) ELISA kit, Species Rat, Sample Type serum, plasma	96T	913-Eur	Cusabio	elisa
orb81264	Human Progrmammed Cell Death 5 protein PDCD5 Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 125 amino acids and having a molecular mass of 14 kDa. For resear	5	154-Eur	Biorb	recombinant
orb81363	Human Solute Carrier Family 4, Sodium Bicarbonate Cotransporter, Member 4 protein SLC4A4 produced in E.coli is a single, non-glycosylated polypeptide chain containing 460 amino acids (1-424 a.a.) and	5	154-Eur	Biorb	recombinant
orb80034	Rhesus Macaque GCSF protein Granulocyte MCSF Monkey Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 127 amino acids and having a molecular mass of 14.4 kDa.	2	154-Eur	Biorb	recombinant
25-699	C4BPA is a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. Along with a single, unique beta-chain, seven identic	0.05 mg	632-Eur	Prosci	Proteins
orb80406	Porcine IL1 alpha protein IL1A Porice Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 158 amino acids and having a molecular mass of 18076 Dalton. The IL-1A	2	154-Eur	Biorb	recombinant
orb81300	Human Ras-Related C3 Botulinum Toxin Substrate 2 protein Recombinant RAC2 produced in E.coli is a single, non-glycosylated polypeptide chain containing 419 amino acids and having a molecular mass of 4	5	154-Eur	Biorb	recombinant
290-63701	Triglyceride Assay Kit Lipids in serum consist of triglycerides, cholesterols, phospholipids, free fatty acids and slight amounts of fat_soluble components such as fatsoluble vitamins and carotenes. T	1,000 tests	467-Eur	BBridge	elisa
orb80455	Mouse IL17A protein IL17 Murine Recombinant produced in E.coli is homodimeric, non-glycosylated polypeptide chain containing total of 266 amino acids and having a molecular mass of 29,956 Dalton. The	5	154-Eur	Biorb	recombinant
orb80275	Human Pro BMP2 protein Pro BMP -2 Human Recombinant is the precursor of BMP-2 which has intramolecular cystein bridges is homodimer, non-glycosylated, polypeptide chain containing 377 amino acids and	2	154-Eur	Biorb	recombinant
EIAAB12837	3-keto acyl-CoA synthase ELOVL2,Elongation of very long chain fatty acids protein 2,ELOVL2,Homo sapiens,Human,SSC2		1109-Eur	EIAab
EIAAB12834	3-keto acyl-CoA synthase ELOVL1,CGI-88,Elongation of very long chain fatty acids protein 1,ELOVL1,Homo sapiens,Human,SSC1		1109-Eur	EIAab
orb90217	Human Phosphogluconate Dehydrogenase protein PGD Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 503 amino acids (1-483 a.a.) and having a molecular ma	5	154-Eur	Biorb	recombinant
orb81253	Human Proliferation-associated protein 2G4 protein PA2G4 produced in E.coli is a single, non-glycosylated polypeptide chain containing 402 amino acids (1-394 a.a.) and having a molecular mass of 44.8k	5	154-Eur	Biorb	recombinant
orb90251	Human ProMMP9 protein Pro-MMP-9 Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 688 amino acids fragment (20-707) corresponding to the pro form of the	2	154-Eur	Biorb	recombinant
orb80421	Human IL4 protein Human IL4 Recombinant produced in CHO is a single, non-glycosylated polypeptide chain containing 129 amino acids and having a molecular mass of 14 kDa, the glycosilation of IL-4 migr	2	154-Eur	Biorb	recombinant
B004	*Yeast Nitrogen Base w_o Amino Acids and Amnonium Sulphates USE For classification of yeasts on the basis of their ability to assimilate carbon and nitrogen compounds.	Qty per Litre of Medium: 1,7	2-Eur	biomarkt	cat
orb81173	Human IPP-POZ protein IPP-POZ Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 157 amino acids having a molecular mass of 17.3 kDa. For research use only	10	154-Eur	Biorb	recombinant
B004	Yeast Nitrogen Base w_o Amino Acids and Amnonium Sulphates USE: For classification of yeasts on the basis of their ability to assimilate carbon and nitrogen compounds.	5x500gm	----Eur	biomarkt
orb80322	Human FGF 22 protein FGF 22 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 149 amino acids and having a molecular mass of 17.3 kDa. The FGF-22 is purif	2	154-Eur	Biorb	recombinant
orb90073	Human Dihydrolipoamide Dehydrogenase protein DLD Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 511 amino acids (36-509 a.a.) and having a molecular m	5	154-Eur	Biorb	recombinant
orb80026	Human FGF 9 protein FGF 9 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 207 amino acids and having a molecular mass of 23.4 kDa. The FGF-9 is purifie	5	154-Eur	Biorb	recombinant
orb80414	Mouse IL2 His tag protein IL2 Mouse Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 170 amino acids (21-169 a.a) and having a molecular mass of 19.5kDa. The m	10	154-Eur	Biorb	recombinant
60-001	anti_GFP antibody, rat monoclonal The green fluorescent protein (GFP) is composed of 238 amino acids (26.9 kDa), originally isolated from the jellyfish Aequorea victoria that fluoresces green when exp	100 ug	----Eur	BBridge	monoclonal
orb80060	Canine IL3 protein IL3 Canine Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 120 amino acids and having a molecular mass of 14 kDa. The IL-3 is purified by p	2	154-Eur	Biorb	recombinant
orb80434	Mouse IL7 protein IL7 Mouse Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 130 amino acids and having a molecular mass of 15.0 kDa. The IL-7 is purified by p	2	154-Eur	Biorb	recombinant
orb80668	Human IP-10 His tag protein IP-10 His Tag Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 77 amino acids fragment (22-98) and having total molecular ma	5	154-Eur	Biorb	recombinant
orb81543	Herpes Simplex Virus-2 gG protein The E.coli derived recombinant protein contains the HSV-2 gG immunodominant regions, 525-578 amino acids, the total MW is 32,100 Dalton, fused with 26 kDa GST-tag. Fo	100	228-Eur	Biorb	recombinant
EGE-243	Nucleic acids: pLEXSY_I-blecherry3 integrative inducible expression vectorantibiotic selection of transfectants with LEXSY Bleo and expression monitoring with Cherry fluorescence	5	467-Eur	Jena Bio
orb80046	Human IGF1 Des (1-3) protein IGF-I Des(1-3) Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 67 amino acids (aa 4-70) and having a molecular mass of 737	20	154-Eur	Biorb	recombinant
SMC-314D	NAV1.7, S68-6 Monoclonals AntibodiesS68-6 Fusion protein amino acids 1751-1946 (C-terminus) of human Nav1.7, accession number Q15858	100ug	324-Eur	Stressmarq
orb81723	HIV-1 TAT Clade-B protein HIV-1 TAT Recombinant- produced in E.coli is a single, non-glycosylated, polypeptide chain containing 86 amino acids encoded by two exons and having chain having a molecular	2	154-Eur	Biorb	recombinant
orb80461	Rat IL17E protein IL17E Rat Recombinant produced in E.coli is homodimeric, non-glycosylated polypeptide chain containing 145 amino acids and having a molecular mass of 35.5 kDa. The IL-25 Rat is purif	5	154-Eur	Biorb	recombinant
orb80954	Human Bcl2-BH3 protein Bcl-2 Des BH3 domain (93-107 residues) Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 203 amino acids 1-92 and 108-218.The Bcl-2	2	154-Eur	Biorb	recombinant
SMC-369D	SAP97 Antibody Monoclonal, Clone number: S64-15 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 1-104 of rat SAP97	100ug	279-Eur	Stressmarq
orb81072	Human Down-Regulator of Transcription 1 protein DR1 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 196 amino acids (1-176 a.a.) and having a molecular	5	154-Eur	Biorb	elisa
orb80462	Rat IL17F protein IL17F Rat Recombinant produced in E.coli is homodimeric, non-glycosylated polypeptide chain containing total of 270 amino acids and having a molecular mass of 30 kDa. The Rat IL-17F	5	154-Eur	Biorb	recombinant
orb80955	Human Bcl2-BH4 protein Bcl-2 Des BH4 domain (10-30 residues) Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 197 amino acids 1-9 and 31-218.The Bcl-2 is	2	154-Eur	Biorb	recombinant
SMC-344D	TrpC5, S67-15 Monoclonals AntibodiesS67-15 Synthetic peptide amino acids 827-845 of human TrpC5 (also known as short transient receptor potential channel 5, and Htrp5	100ug	324-Eur	Stressmarq
SMC-376D	Nav1.1, S74-71 Monoclonals AntibodiesS74-71 Fusion protein amino acids 1929-2009 (cytoplamsic Cterminus) of rat Nav1.1, accession number P04774.	100ug	324-Eur	Stressmarq
bs-2015P	Peptides: S100B(S100 calcium binding protein B)(human, mouse, rat, bovine, Rabbit, chicken) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
orb80443	Rat IL13 protein IL13 Rat Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 113 amino acids and having a molecular mass of 12.7 kDa.The IL-13 is purified by pro	2	154-Eur	Biorb	recombinant
SMC-331D	BK channel BETA2, S53-32 Monoclonals AntibodiesS53-32 Fusion protein amino acids 1-41 (N-terminus) and 218-235 (C-terminus) of mouse BKBeta2 (accession number Q9CZM9)	100ug	324-Eur	Stressmarq
SMC-303D	CAV3.2, S55-10 Monoclonals AntibodiesS55-10 Fusion protein amino acids 1019-1293 (II-III loop) of human Cav3.2, accession number O95180	100ug	324-Eur	Stressmarq
orb80953	Human Bcl2-BH2 protein Bcl-2 Des BH2 domain (187-202 residues) Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 202 amino acids 1-186 and 203-218.The Bcl	2	154-Eur	Biorb	recombinant
EGE-255	Nucleic acids: pLEXSY_IE-blecherry4 episomal inducible expression vectorantibiotic selection of transfectants with LEXSY Bleo and expression monitoring with Cherry fluorescence	5	467-Eur	Jena Bio
orb81211	Human MYC Associated Factor X protein MAX Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 168 amino acids (1-160 a.a.) and having a molecular mass of 1	5	154-Eur	Biorb	recombinant
SMC-316D	TRPM7, S74-25 Monoclonals AntibodiesS74-25 Fusion protein amino acids 1817-1863 (C- terminus) of mouse TrpM7, accession number Q923J1	100ug	324-Eur	Stressmarq
orb81724	HIV-1 TAT Clade-C protein HIV-1 TAT Recombinant- produced in E.coli is a single, non-glycosylated, polypeptide chain containing 100 amino acids encoded by two exons and having chain having a molecular	2	154-Eur	Biorb	recombinant
orb80145	Human MDC protein MDC Human Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 69 amino acids and having a molecular mass of 8.1 kDa. The MDC is purified by proprietary c	5	154-Eur	Biorb	recombinant
NU-808-612Q	Nucleic acids: EDA-ATP - ATTO-612Q	40	746-Eur	Jena Bio
NU-830-5FM	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - 5-FAM	160	746-Eur	Jena Bio
NU-808-THIO12	Nucleic acids: EDA-ATP - ATTO-Thio12	40	746-Eur	Jena Bio
NU-820-THIO12	Nucleic acids: EDA-GTP - ATTO-Thio12	40	746-Eur	Jena Bio
NU-830-CY5	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - Cy5	320	746-Eur	Jena Bio
NU-830-CY3	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - Cy3	160	746-Eur	Jena Bio
NU-802-THIO12	Nucleic acids: EDA-ADP - ATTO-Thio12	40	746-Eur	Jena Bio
NU-830-776	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - DY-776	80	746-Eur	Jena Bio
NU-830-751	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - DY-751	80	746-Eur	Jena Bio
NU-829-776	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - DY-776	80	746-Eur	Jena Bio
NU-829-ROX	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - 6-ROX	160	746-Eur	Jena Bio
NU-820-RHO13	Nucleic acids: EDA-GTP - ATTO-Rho13	40	746-Eur	Jena Bio
NU-829-CY3	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - Cy3	160	746-Eur	Jena Bio
NU-830-6FM	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - 6-FAM	160	746-Eur	Jena Bio
NU-808-RHO6G	Nucleic acids: EDA-ATP - ATTO-Rho6G	40	746-Eur	Jena Bio
NU-808-RHO14	Nucleic acids: EDA-ATP - ATTO-Rho14	40	746-Eur	Jena Bio
NU-808-RHO13	Nucleic acids: EDA-ATP - ATTO-Rho13	40	746-Eur	Jena Bio
NU-827-485XL	Nucleic acids: EDA-m7GDP - DY-485XL	40	746-Eur	Jena Bio
NU-807-ROX	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - 6-ROX	160	746-Eur	Jena Bio
NU-807-JOE	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - 6-JOE	160	746-Eur	Jena Bio
NU-807-CY5	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - Cy5	40	209-Eur	Jena Bio
NU-807-CY3	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - Cy3	320	746-Eur	Jena Bio
NU-807-776	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - DY-776	80	746-Eur	Jena Bio
NU-807-751	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - DY-751	80	746-Eur	Jena Bio
NU-807-6FM	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - 6-FAM	160	746-Eur	Jena Bio
NU-824-480XL	Nucleic acids: EDA-m7GTP - DY-480XL	40	746-Eur	Jena Bio
NU-824-485XL	Nucleic acids: EDA-m7GTP - DY-485XL	40	746-Eur	Jena Bio
NU-808-540Q	Nucleic acids: EDA-ATP - ATTO-540Q	40	746-Eur	Jena Bio
NU-808-580Q	Nucleic acids: EDA-ATP - ATTO-580Q	40	746-Eur	Jena Bio
NU-808-RHO12	Nucleic acids: EDA-ATP - ATTO-Rho12	40	746-Eur	Jena Bio
NU-808-RHO11	Nucleic acids: EDA-ATP - ATTO-Rho11	40	746-Eur	Jena Bio
NU-808-RHO101	Nucleic acids: EDA-ATP - ATTO-Rho101	50	209-Eur	Jena Bio
NU-821-480XL	Nucleic acids: Aminoallyl-UTP - DY-480XL	40	746-Eur	Jena Bio
NU-830-JOE	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - 6-JOE	160	746-Eur	Jena Bio
NU-827-480XL	Nucleic acids: EDA-m7GDP - DY-480XL	40	746-Eur	Jena Bio
NU-821-485XL	Nucleic acids: Aminoallyl-UTP - DY-485XL	40	746-Eur	Jena Bio
NU-829-751	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - DY-751	80	746-Eur	Jena Bio
NU-829-6FM	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - 6-FAM	160	746-Eur	Jena Bio
NU-808-647N	Nucleic acids: EDA-ATP - ATTO-647N	10	209-Eur	Jena Bio
NU-807-5FM	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - 5-FAM	160	746-Eur	Jena Bio
NU-831-480XL	Nucleic acids: 5-Propargylamino-CTP - DY-480XL	40	746-Eur	Jena Bio
NU-820-580Q	Nucleic acids: EDA-GTP - ATTO-580Q	40	746-Eur	Jena Bio
NU-829-CY5	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - Cy5	160	746-Eur	Jena Bio
NU-820-RHO11	Nucleic acids: EDA-GTP - ATTO-Rho11	40	746-Eur	Jena Bio
NU-820-RHO101	Nucleic acids: EDA-GTP - ATTO-Rho101	40	746-Eur	Jena Bio
NU-831-485XL	Nucleic acids: 5-Propargylamino-CTP - DY-485XL	40	746-Eur	Jena Bio
NU-829-5FM	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - 5-FAM	160	746-Eur	Jena Bio
NU-820-612Q	Nucleic acids: EDA-GTP - ATTO-612Q	40	746-Eur	Jena Bio
NU-829-JOE	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - 6-JOE	160	746-Eur	Jena Bio
NU-802-647N	Nucleic acids: EDA-ADP - ATTO-647N	10	209-Eur	Jena Bio
NU-802-612Q	Nucleic acids: EDA-ADP - ATTO-612Q	40	746-Eur	Jena Bio
NU-802-580Q	Nucleic acids: EDA-ADP - ATTO-580Q	40	746-Eur	Jena Bio
NU-802-540Q	Nucleic acids: EDA-ADP - ATTO-540Q	40	746-Eur	Jena Bio
NU-820-RHO14	Nucleic acids: EDA-GTP - ATTO-Rho14	40	746-Eur	Jena Bio
NU-802-RHO11	Nucleic acids: EDA-ADP - ATTO-Rho11	40	746-Eur	Jena Bio
NU-802-RHO12	Nucleic acids: EDA-ADP - ATTO-Rho12	40	746-Eur	Jena Bio
NU-820-540Q	Nucleic acids: EDA-GTP - ATTO-540Q	40	746-Eur	Jena Bio
NU-802-RHO13	Nucleic acids: EDA-ADP - ATTO-Rho13	40	746-Eur	Jena Bio
NU-802-RHO14	Nucleic acids: EDA-ADP - ATTO-Rho14	40	746-Eur	Jena Bio
NU-830-ROX	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - 6-ROX	160	746-Eur	Jena Bio
NU-802-RHO101	Nucleic acids: EDA-ADP - ATTO-Rho101	40	746-Eur	Jena Bio
NU-820-RHO6G	Nucleic acids: EDA-GTP - ATTO-Rho6G	40	746-Eur	Jena Bio
NU-820-647N	Nucleic acids: EDA-GTP - ATTO-647N	40	746-Eur	Jena Bio
NU-820-RHO12	Nucleic acids: EDA-GTP - ATTO-Rho12	40	746-Eur	Jena Bio
NU-802-RHO6G	Nucleic acids: EDA-ADP - ATTO-Rho6G	40	746-Eur	Jena Bio
SMC-185D	HIF2 alpha Antibody Monoclonal, Clone number: EP190B Host: Mouse, Isotype: IgG1 Immunogen: GST-human EPAS-1 (HIF2alpha) amino acids 535-631 fusion protein	100ug	252-Eur	Stressmarq
SMC-185C	HIF2 alpha Antibody Monoclonal, Clone number: EP190B Host: Mouse, Isotype: IgG1 Immunogen: GST-human EPAS-1 (HIF2alpha) amino acids 535-631 fusion protein	25ug	116-Eur	Stressmarq
orb80053	Rhesus Macaque IL1 beta protein IL1 beta Monkey Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 153 amino acids and having a molecular mass of 17.3 kDa. The IL-1b is p	2	154-Eur	Biorb	recombinant
orb90244	Human Peroxiredoxin 3 protein PRDX3 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 195 amino acids (63-256 a.a.) and having a molecular mass of 21.5 k	5	154-Eur	Biorb	recombinant
orb81041	Human Copper Metabolism Domain Containing 1 protein COMMD1 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 210 amino acids (1-190 a.a.) and having a mol	2	154-Eur	Biorb	recombinant
orb90186	Human MMP3 GST-Tag protein MMP-3 Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain fused to GST tag containing 228 amino acids (251-478) and having total molecular	2	277-Eur	Biorb	recombinant
orb81462	Human Vesicle-Associated Membrane Protein 4 protein VAMP4 produced in E.coli is a single, non-glycosylated polypeptide chain containing 123 amino acids (1-115 a.a.) and having a molecular mass of 14.5	2	154-Eur	Biorb	recombinant
orb90189	Human MMP9 protein MMP-9 Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 338 amino acids fragment (113-450) corresponding to the catalytic domain of th	2	154-Eur	Biorb	recombinant
orb80581	Mouse Sonic HedgeHog His tag protein SHH Mouse Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 183 amino acids (25-198 a.a.) and having a molecular mass of 2	5	154-Eur	Biorb	recombinant
orb90173	Human Monoamine Oxidase B protein MAO-B Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 488 amino acids fragment (2-489) corresponding to the cytoplasm	2	154-Eur	Biorb	recombinant
orb81267	Human Phosphoprotein Enriched in Astrocytes 15 protein PEA15 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 130 amino acids (1-130 a.a.) and having a	2	154-Eur	Biorb	recombinant
orb90191	Human N-Acetyltransferase 6 protein Recombinant Human NAT6 produced in E.coli is a single, non-glycosylated polypeptide chain containing 328 amino acids (1-308 a.a.) and having a molecular mass of 35.	2	277-Eur	Biorb	recombinant
orb90012	Human Acyl-Coenzyme Dehydrogenase, C-2 to C-3 protein ACADS Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 409 amino acids (25-412 a.a.) and having a m	2	154-Eur	Biorb	recombinant
orb80865	Human Phosphoribosyl Pyrophosphate Synthetase 1 protein PRPS1 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 338 amino acids (1-318 a.a.) and having mo	5	154-Eur	Biorb	recombinant
orb90045	Human 2,3-Bisphosphoglycerate Mutase protein BPGM Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 267 amino acids (1-259 a.a.) and having a molecular m	5	154-Eur	Biorb	recombinant
orb80300	Human EGF 21-Leu protein EGF 21-Leu Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 53 amino acids and having a molecular mass of 6205 Dalton.The EGF 2	20	154-Eur	Biorb	recombinant
orb80960	Human Bcl2 XL protein Bcl-XL Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing amino acids 1-210. The Bcl-XL is purified by proprietary chromatographic te	2	154-Eur	Biorb	recombinant
orb90198	Human NAD(P)H Dehydrogenase Quinone 2 protein NQO2 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 251amino acids (1-231 a.a.) and having a molecular m	5	154-Eur	Biorb	recombinant
orb90245	Human Peroxiredoxin 4 protein PRDX4 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 255 amino acids (38-271 a.a.) and having a molecular mass of 28.8kD	5	154-Eur	Biorb	recombinant
orb90126	Glutathione S-Transferase His Tag protein Recombinant Schistosoma japonicum GST full length protein contains 244 amino acids(1-224 a.a.) expressed in E.coli, having a molecular mass of 28.3kDa. The GS	10	154-Eur	Biorb	recombinant
orb81153	Human Hemoglobin-Zeta protein HBZ Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 150 amino acids (1-142 a.a.) and having a molecular mass of 16.7 kDa.	5	154-Eur	Biorb	recombinant
27-778	Under hypertonic conditions the induction of SLC38A2_SNAT2 leads to the stimulation of transport system A and to the increase in the cell content of amino acids. Its amino acid response element, along	0.1 mg	496-Eur	Prosci
26-625	Carboxypeptidase N is a plasma metallo-protease that cleaves basic amino acids from the C terminal of peptides and proteins. The enzyme is important in the regulation of peptides like kinins and anaph	0.05 mg	632-Eur	Prosci	Proteins
orb90194	E.coli Dihydropteridine Reductase protein NFNB Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 237 amino acids (1-217 a.a.) and having a molecular mass of 26	5	154-Eur	Biorb	recombinant
orb80411	Human ST2 protein ST2 Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 310 amino acids fragment (19-328) corresponding to the soluble ST2 coding sequenc	2	154-Eur	Biorb	recombinant
orb80582	Human Desert HedgeHog protein DHH Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 197 amino acids (23-198) and having a molecular mass of 22 kDa. DHH i	5	154-Eur	Biorb	recombinant
orb90218	Human Phosphoethanolamine_Phosphocholine Phosphatase protein Human Phospho1 Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 295 amino acids and having a mole	2	154-Eur	Biorb	recombinant
orb81271	Human Profilin 2 protein PFN2 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 160 amino acids (1-140 a.a.) and having a molecular mass of 17.2 kDa. PFN	2	154-Eur	Biorb	recombinant
orb80777	Human Cyclin-H protein CCNH Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 343 amino acids (1-323 a.a.) and having a molecular mass of 39.8 kDa. The C	5	154-Eur	Biorb	recombinant
31-265	Under hypertonic conditions the induction of SLC38A2_SNAT2 leads to the stimulation of transport system A and to the increase in the cell content of amino acids. Its amino acid response element, along	0.05 mg	632-Eur	Prosci
orb90231	Human Phenylethanolamine-N-Methyltransferase protein Recombinant Human PNMT produced in E.coli is a single, non-glycosylated polypeptide chain containing 282 amino acids (1-282 a.a.) and having a mole	5	154-Eur	Biorb	recombinant
32-196	MSH2 is a 100 kDa nuclear antigen and encodes a protein of 934 amino acids. The MSH2 gene is one of 4 known genes encoding proteins involved in the repair of mismatch nucleotides following DNA replica	0.1 mL	393-Eur	Prosci	dna
orb80166	Exendin-4 protein Exendin-4 Recombinant is novel 39-amino acids peptide having a molecular mass of 4186.7 Dalton, which shares 53%, sequence homology with GLP-17-36 amide and interacts with the same m	20	154-Eur	Biorb	recombinant
orb80945	Human Beta Microglobulin His tag protein B2M Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 120 amino acids (1-119 a.a.) and having a molecular mass of	1	154-Eur	Biorb	recombinant
orb90246	Human Peroxiredoxin 5 protein PRDX5 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 162 amino acids (53-214 a.a.) and having a molecular mass of 17 kDa	5	154-Eur	Biorb	recombinant
orb90018	Human Adenosylhomocysteinase protein AHCY Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 452 amino acids (1-432 a.a.) and having a molecular mass of 49	5	154-Eur	Biorb	recombinant
orb80952	Human Bcl2-BH1 protein Bcl-2 Des BH1 domain (136-155 residues) Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containg 198 amino acids 1-135 and 156-218.The Bcl-2	2	154-Eur	Biorb	recombinant
orb81063	Human Cytoglobin protein CYGB Recombinant E.coli produced in E.coli is a single, non-glycosylated polypeptide chain containing 210 amino acids (1-190 a.a.) and having a molecular mass of 23.5 kDa. The	2	154-Eur	Biorb	recombinant
orb90176	Human Methionine Adenosyltransferase II, Beta protein Recombinant Human MAT2B produced in E.coli is a single, non-glycosylated polypeptide chain containing 323 amino acids (1-323 a.a) and having a mol	5	154-Eur	Biorb	recombinant
orb90011	Human Acyl-Coenzyme Dehydrogenase, C-4 to C-12 protein ACADM Recombinant E.coli produced in E.coli is a single, non-glycosylated polypeptide chain containing 221 amino acids (26-421 a.a.) and having a	2	154-Eur	Biorb	recombinant
orb81242	E.coli Transcription Termination_Antitermination Factor protein NusA Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 495 amino acids and having a molecular ma	20	154-Eur	Biorb	recombinant
orb80419	Human IL3 His tag protein Human IL3 Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 133 amino acids fragment (20-152) and having total molecular mass of 19.5	10	154-Eur	Biorb	recombinant
orb80940	Human Bcl2-Associated Athanogene 1 protein BAG1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 230 amino acids (1-230 a.a.) and having a molecular mas	5	154-Eur	Biorb	recombinant
orb90132	Human Glutathione S-Transferase MU 4 protein GSTM4 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 238 amino acids (1-218 a.a.) and having a molecular m	5	154-Eur	Biorb	recombinant
orb80914	Human Annexin A3 protein ANXA3 produced in E.coli is a single, non-glycosylated polypeptide chain containing 323 amino acids (1-323 a.a.) and having a molecular mass of 36.3 kDa. ANXA3 is purified by	5	154-Eur	Biorb	recombinant
orb81396	Streptavidin His tag protein Streptavidin Streptomyces Avidinii Recombinant fused to N-terminal His-Tag produced in E.coli is a single, non-glycosylated polypeptide chain containing 167 amino acids an	5	154-Eur	Biorb	recombinant
orb80273	Human BMP Receptor-1A HEK protein BMPR1A Human Recombinant produced in HEK-293 cells is a single, glycosylated, polypeptide chain containing 369 amino acids with molecular weight of 43.7 kDa though on	2	154-Eur	Biorb	recombinant
29-177	HKR1 is one of the GLI-Kruppel family of human genes. Members of this family have similar H-C links, i.e., a conserved stretch of 9 amino acids connecting the C-terminal histidine of one finger to the	0.05 mg	632-Eur	Prosci	human
orb90122	Human Glutaredoxin 5 protein GLRX5 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 177 amino acids (1-157 a.a.) and having a molecular mass of 18.8 kDa	5	154-Eur	Biorb	recombinant
orb90234	Human Cyclophilin F protein PPIF Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 198 amino acids (30-207) and having a molecular mass of 21 kDa. The PP	10	154-Eur	Biorb	recombinant
orb80130	Rat GRO-alpha protein CXCL1 Rat Recombinant produced in E.coli is a single,non-glycosylated, polypeptide chain containing 73 amino acids and having a molecular mass of 7.8 kDa. The Rat CXCL1 is purifi	5	154-Eur	Biorb	recombinant
orb82821	CXCL1 protein Recombinant Rat CXCL1_GRO is a single, non-glycosylated polypeptide chain containing 72 amino acids. CXCL1_GRO belongs to the CXC family of chemokines that can signal through the CXCR1 o	1 mg	1980-Eur	Biorb	recombinant
orb80476	Human IL29 protein IL-29 human recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 181 amino acids and having a molecular mass of 20 kDa. For research use only.	5	154-Eur	Biorb	recombinant
orb80413	Human IL2 His Tag protein Human IL2 Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 133 amino acids fragment (21-153) having molecular weight of 20kDa and fu	2	154-Eur	Biorb	recombinant
orb90070	Human D-Dopachrome Tautomerase protein DDT Recombinant E.coli produced in E.coli is a single, non-glycosylated polypeptide chain containing 138 amino acids (1-118 a.a.) and having a molecular mass of	5	154-Eur	Biorb	recombinant
orb81484	E.coli DnaJ (HSP40) protein Recombinant Dna-J produced in E.coli is a single, non-glycosylated polypeptide chain containing 376 amino acids and having a molecular mass of 41.1 kDa. For research use on	20	154-Eur	Biorb	recombinant
bs-1051P	Peptides: Integrin Alpha4 Beta7_LPAM-1 (Lymphocyte Peyer’s patch Adhesion Molecule 1_Integrin alpha4,beta7) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
orb81727	HIV-1 TAT Cys22 protein HIV-1 TAT Cys22 Recombinant- produced in E.coli is a single, non-glycosylated, polypeptide chain containing 86 amino acids mutated in the trans activation domain and having cha	2	154-Eur	Biorb	recombinant
orb81070	Human Dickkopf-Related protein DKK1 produced in Hi-5 is a single, glycosylated polypeptide chain containing 253 amino acids (32-266 a.a.) and having a molecular mass of 27.8 kDa.DKK1 is expressed with	2	277-Eur	Biorb	human
orb90046	Human Carbonic Anhydrase III protein CA3 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 260 amino acids (1-260 a.a.) and having a molecular mass of 29	5	154-Eur	Biorb	recombinant
orb80110	Rat TNF-alpha protein TNF-a Rat Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 157 amino acids and having a molecular mass of 17339.44 Dalton. The TNF-alpha	5	154-Eur	Biorb	recombinant
28-469	HKR1 is one of the GLI-Kruppel family of human genes. Members of this family have similar H-C links, i.e., a conserved stretch of 9 amino acids connecting the C-terminal histidine of one finger to the	0.1 mg	496-Eur	Prosci	human
orb90029	Human Aldehyde Dehydrogenase A1 protein ALDH3A1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 473 amino acids (1-453 a.a.) and having a molecular mas	2	154-Eur	Biorb	recombinant
orb90034	Human Adenine Phosphoribosyltransferase protein APRT Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 180 amino acids (1-180 a.a.) and having a molecular	5	154-Eur	Biorb	recombinant
orb90154	Human Isovaleryl Coenzyme Dehydrogenase protein IVD Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 415 amino acids (33-426 a.a.) and having a molecular	5	154-Eur	Biorb	recombinant
orb80430	Porcine IL6 protein IL6 Porcine Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 184 amino acids and having a molecular mass of 21,113 Dalton. The IL-6 is puri	2	228-Eur	Biorb	recombinant
orb81772	Measles Virus Fusion Mosaic (106-114,519-550) protein The E.coli derived recombinant protein contains the large hemagglutinin immunodominant regions, 106-114 and 519-550 amino acids. For research use	100	228-Eur	Biorb	recombinant
orb90174	Human Methionine Adenosyltransferase I, Alpha protein MAT1A Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 414 amino acids (1-395 a.a.) and having a mo	2	154-Eur	Biorb	recombinant
orb90016	Human AminoAcylase-1 protein ACY1 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 428 amino acids (1-408 a.a.) and having a molecular mass of 21.7 kDa.	2	154-Eur	Biorb	recombinant
orb80276	Human BMP5 protein BMP-5 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 139 amino acids (317-454 a.a.) and having total molecular mass of 15.7 kDa.BMP	5	154-Eur	Biorb	recombinant
orb80669	Mouse IP-10 protein IP-10 Mouse Recombinant produced in E.coli is a single,non-glycosylated, polypeptide chain containing 77 amino acids and having a molecular mass of 8701Dalton. The IP-10 is purifie	5	154-Eur	Biorb	recombinant
orb81293	Human Pentraxin-3 protein Recombinant Human PTX3 produced in E.coli is a single, non-glycosylated polypeptide chain containing 401 amino acids (18-381 a.a) and having a molecular mass of 44.4 kDa. PTX	5	154-Eur	Biorb	recombinant
orb80619	Porcine TNF-alpha protein TNF-a Porcine Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 157 amino acids and having a molecular mass of 17,274 Dalton. The TNF	5	154-Eur	Biorb	recombinant
orb90105	Human Guanidinoacetate N-Methyltransferase protein Recombinant Human GAMT produced in E.coli is a single, non-glycosylated polypeptide chain containing 256 amino acids (1-236 a.a) and having a molecul	5	154-Eur	Biorb	recombinant
orb90140	Human Histone Acetyltransferase 1 protein HAT1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 343 amino acids (20-341 a.a.) and having a molecular mas	2	154-Eur	Biorb	recombinant
orb81268	Human Phosphatidylethanolamine Binding protein PEBP1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 187 amino acids (1-187 a.a.) and having a molecula	10	154-Eur	Biorb	recombinant
26-055	DEGS1 is a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consen	0.05 mg	632-Eur	Prosci
orb90152	Human IMP Dehydrogenase 1 protein IMPDH1 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 534 amino acids (1-514 a.a.) and having a molecular mass of 57.	2	154-Eur	Biorb	recombinant
orb80069	Rat IL10 protein IL-10 Recombinant Rat produced in E.coli is a single, glycosylated polypeptide chain containing 160 amino acids and having a molecular mass of 18.7 kDa. The IL10 Mouse is purified by	2	154-Eur	Biorb	recombinant
orb80422	Human IL4 His tag protein Human IL4 Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 150 amino acids fragment (25-153) and having total molecular mass of 19.6	5	154-Eur	Biorb	recombinant
orb81310	Human Reticulocalbin 1 protein RCN1 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 341 amino acids (30-331 a.a.) and having a molecular mass of 22.5 kD	2	154-Eur	Biorb	recombinant
orb81463	Human Synaptobrevin-5 protein VAMP5 produced in E.coli is a single,non-glycosylated polypeptide chain containing 109 amino acids (1-72 a.a.) and having a molecular mass of 12.7 kDa.VAMP5 is fused to 3	5	154-Eur	Biorb	recombinant
orb80027	Human FGF 19 protein FGF19 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 195 amino acids and having a molecular mass of 21.8 kDa.The FGF-19 is purifi	5	154-Eur	Biorb	recombinant
orb81464	Human Synaptobrevin-8 protein VAMP8 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 96 amino acids (1-76 a.a.) and having a molecular mass of 10.9 kDa.	5	154-Eur	Biorb	elisa
orb80525	Human Myotrophin protein MTPN Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 138 amino acids (1-118 a.a.) and having a molecular mass of 15 kDa. The MT	5	154-Eur	Biorb	recombinant
orb80915	Human Annexin A4 protein ANXA4 produced in E.coli is a single, non-glycosylated polypeptide chain containing 321 amino acids (1-321 a.a.) and having a molecular mass of 36 kDa. ANXA4 is purified by pr	2	154-Eur	Biorb	recombinant
orb81235	NKp46 protein NKp46 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 235 amino acids and having a molecular mass of 26.6 kDa. For research use only.	5	154-Eur	Biorb	recombinant
SMC-392D	KCC2 Antibody Monoclonal, Clone number: S1-12 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 932-1043 corresponding to rat KCC2	100ug	279-Eur	Stressmarq
orb80318	Human FGF 21 His tag protein Fibroblast Growth Factor -21 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 202 amino acids (29-209) and having a molecul	10	154-Eur	Biorb	recombinant
SMC-393D	VAChT Antibody Monoclonal, Clone number: S6-38 Host: Mouse, Isotype: IgG1 Immunogen: Synthetic peptide amino acids 521-532 of human VACht	100ug	279-Eur	Stressmarq
orb81460	Human Synaptobrevin-2 protein VAMP2 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 126 amino acids (1-89) and having a molecular mass of 13.8 kDa. The	5	154-Eur	Biorb	recombinant
orb80432	Human IL7 protein Human IL7 Recombinant produced in yeast is a single, glycosylated polypeptide chain containing 152 amino acids and having a molecular mass of 17.4 kDa. The IL7 is purified by proprie	2	154-Eur	Biorb	recombinant
orb81579	Hepatitis Virus NS3 Genotype-1c protein The E.coli derived recombinant His-Tag fusion protein contains the HCV NS3 immunodominant regions, amino acids 1192-1459. For research use only.	100	228-Eur	Biorb	recombinant
orb80332	Human Galectin 3 His Tag protein LGALS3 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 270 amino acids (1-250 a.a.) and having a molecular mass of 28.	5	154-Eur	Biorb	recombinant
orb80801	Human MAPKHis Tag protein MAPK1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 380 amino acids (1-360 a.a.) and having a molecular mass of 43.5 kDa. T	5	154-Eur	Biorb	recombinant
orb80798	Human MAPKHis Tag protein MAPK3 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 399 amino acids (1-379 a.a.) and having a molecular mass of 45.2 kDa. T	5	154-Eur	Biorb	recombinant
orb80433	Human IL7 His tag protein Human IL7 Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 152 amino acids fragment (26-177) and having total molecular mass of 21.9	2	154-Eur	Biorb	recombinant
orb90131	Mouse Glutathione S-Transferase M1 His-Tag protein GSTM1 Mouse Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 238 amino acids (1-218 a.a.) and having a mole	5	154-Eur	Biorb	recombinant
orb80329	Human Galectin 2 protein LGALS2 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 152 amino acids (1-132 a.a.) and having a molecular mass of 16.8 kDa. T	5	154-Eur	Biorb	recombinant
orb81376	Human Snurportin 1 protein SNUPN Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 380 amino acids (1-360 a.a.) and having a molecular mass of 43.3 kDa. T	5	154-Eur	Biorb	recombinant
orb80817	Human Galactokinase 1 protein GALK1 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 412 amino acids (1-392 a.a.) and having a molecular mass of 44.4 kDa	5	154-Eur	Biorb	recombinant
orb80916	Human Annexin A5 protein ANXA5 produced in E.coli is a single, non-glycosylated polypeptide chain containing 320 amino acids (1-320 a.a.) and having a molecular mass of 35.9 kDa.ANXA5 is purified by p	5	154-Eur	Biorb	recombinant
orb81272	Human Profilin 4 protein PFN4 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 149 amino acids (1-129 a.a.) and having a molecular mass of 16.4 kDa. PFN	5	154-Eur	Biorb	recombinant
orb81281	Human Transthyretin protein Transthyertin Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 128 amino acids (21-147 a.a.) and having molecular wieght of 1	5	154-Eur	Biorb	recombinant
orb80259	Human Apolipoprotein A-I protein APOA1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 264 amino acids (25-267 a.a.) and having a molecular mass of 30.	20	154-Eur	Biorb	recombinant
orb81029	Human Chromogranin His Tag protein Recombinant Human CHGA produced in E.coli is a single, non-glycosylated polypeptide chain containing 477 amino acids (19-457 a.a) and having a molecular mass of 53.3	5	154-Eur	Biorb	recombinant
orb80108	Human TNF-alpha His tag protein TNF-a Human Recombinant His produced in E.coli is a single, non-glycosylated, polypeptide chain containing 157 amino acids fragment (77-233) and having a molecular mass	10	154-Eur	Biorb	recombinant
orb80310	Human FGF basic (147 a.a) protein FGF 2 Human Recombinant (FGF-2) produced in E.coli is a single, non-glycosylated, polypeptide chain containing 147 amino acids and having a molecular mass of 16539 Da	10	154-Eur	Biorb	recombinant
orb80667	Human IL8 (1-77) His tag protein IL8 Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 77 amino acids fragment (23-99) and having total molecular mass of	10	154-Eur	Biorb	recombinant
SMC-402D	GABA-B Receptor 2 Antibody Monoclonal, Clone number: S81-2 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 861-912 of rat GABA(B)R2	100ug	279-Eur	Stressmarq
orb80666	Human IL8 (1-77) protein Human IL8 Recombinant produced in Yeast is a single, glycosylated polypeptide chain containing 79 amino acids and having a molecular mass of kDa. The IL-8 is purified by propr	5	154-Eur	Biorb	recombinant
orb81330	Human RuvB-Like 1 protein RUVBL1 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 476 amino acids (1-456 a.a.) and having a molecular mass of 44.8 kDa. T	5	154-Eur	Biorb	recombinant
orb81025	Human Centrin-3 protein CETN3 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 187 amino acids (1-167 a.a.) and having a molecular mass of 21.7 kDa. CET	5	154-Eur	Biorb	recombinant
SMC-401D	SNAT1 Antibody Monoclonal, Clone number: S104-32 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 1- 63 of rat SNAT1	100ug	279-Eur	Stressmarq
orb80323	Human FGF 23 protein FGF 23 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain expressed with -6xHis tag containing total of 257 amino acids (251 a.a. FGF23+ a.a. His	2	154-Eur	Biorb	recombinant
orb80917	Human Annexin A6 protein ANXA6 produced in E.coli is a single, non-glycosylated polypeptide chain containing 693 amino acids (1-673 a.a.) and having a molecular mass of 78 kDa. ANXA6 is fused to 20 am	2	154-Eur	Biorb	recombinant
orb81410	Human Transgelin protein TAGLN Recombinant E.coli produced in E.coli is a single, non-glycosylated polypeptide chain containing 221 amino acids (1-201 a.a.) and having a molecular mass of 24.8 kDa. Th	5	154-Eur	Biorb	recombinant
orb81412	Human T-cell Leukemia_Lymphoma 1A protein TCL1A Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 114 amino acids (1-114 a.a.) and having a molecular mas	10	154-Eur	Biorb	recombinant
orb80611	Human TGF Beta (113 a.a.) protein TGF-b Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 113 amino acids (279-390 a.a.) and having total molecular mass	2	154-Eur	Biorb	recombinant
orb82769	Human Serpin F1 protein Recombinant Human Pigment Epithelium-derived Factor is a single non-glycosylated polypeptide chain containing 400 amino acids. For research use only.	1 mg	2308-Eur	Biorb	recombinant
orb81027	Human Chromogranin protein Recombinant Human CHGA produced in E.coli is a single, non-glycosylated polypeptide chain containing 114 amino acids (19-131 a.a) and having a molecular mass of 12.8 kDa. Ch	5	154-Eur	Biorb	recombinant
orb81427	Human TNF receptor-Associated Factor 1 protein TRAF1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 172 amino acids (266-416 a.a.) and having a molecu	5	154-Eur	Biorb	recombinant
orb80621	Human TNF-beta His tag protein TNF -b His Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 171 amino acids fragment (35-205) and having a molecular mass	5	154-Eur	Biorb	recombinant
orb80268	Human Apolipoprotein-M protein APOM Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 187 amino acids (23-188 a.a.) and having a molecular mass of 20.9 k	2	154-Eur	Biorb	recombinant
orb80610	Human TGF Beta His Tag protein TGF-b Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 112 amino acids fragment (279-390) having molecular weight of 17.3	2	154-Eur	Biorb	recombinant
orb80431	Human Soluble IL-6 Receptor alpha protein sIL-6R Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 338 amino acids (20-357) corresponding to the mature IL	5	154-Eur	Biorb	recombinant
orb80429	Human IL6 His tag protein Human IL6 Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 184 amino acids fragment (29-211) and having total molecular mass of 25.4	10	154-Eur	Biorb	recombinant
orb80925	Human ADP-Ribosylation Factor-Like 1 protein ARL1 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 201 amino acids (1-181 a.a.) and having a molecular ma	5	154-Eur	Biorb	recombinant
orb80990	Human Calreticulin protein CALR Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 421 amino acids (18-417 a.a.) and having a molecular mass of 48.7 kDa.	5	154-Eur	Biorb	recombinant
SPC-317D	Alfa Hsp90C (Plant) Polyclonals Ab, Host Rabbit C-terminal238 amino acids of Hsp90C expressed with N- and C-terminal hexahistidine tags in E.coli, purified with Ni-NTA.	100ul	338-Eur	Stressmarq
orb80814	Human VEGF receptor-1 His Tag protein FLT1 Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 298 amino acids fragment (31-328) corresponding to the IgG l	2	154-Eur	Biorb	recombinant
orb80335	Human Galectin 9 protein LGALS9 produced in E.coli is a single, non-glycosylated polypeptide chain containing 168 amino acids (1-148 a.a.) and having a molecular mass of 18.5 kDa. Galectin 9 is fused	2	154-Eur	Biorb	recombinant
orb90259	Human Thiosulfate Sulfurtransferase protein Recombinant Human Rhodanese produced in E.coli is a single, non-glycosylated polypeptide chain containing 317 amino acids (1-297 a.a) and having a molecular	5	154-Eur	Biorb	recombinant
orb80810	Human VEGF receptor-1 D1-3 His tag protein FLT1 D1-3 Human Recombinant produced in baculovirus is monomeric, glycosylated, polypeptide containing 298 amino acids fragment (31-328) and having a molecul	2	154-Eur	Biorb	recombinant
orb81113	Human Fas-Associated Death Domain protein FADD produced in E.coli is a single, non-glycosylated polypeptide chain containing 244 amino acids (1-208 a.a.) and having a molecular mass of 27.4 kDa.FADD i	2	154-Eur	Biorb	recombinant
orb81405	Human Sequestosome 1 protein SQSTM1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 264 amino acids (1-356 a.a.) and having a molecular mass of 39.7 kD	5	154-Eur	Biorb	recombinant
orb81303	Human RAN, Member RAS Oncogene Family protein RAN Recombinant E.coli produced in E.coli is a single, non-glycosylated polypeptide chain containing 236 amino acids (1-216 a.a.) and having a molecular m	2	154-Eur	Biorb	recombinant
SMC-335D	Kv3.4 Antibody Monoclonal, Clone number: S72-16 Host: Mouse, Isotype: IgG1 Immunogen: Synthetic peptide amino acids 175-192 of rat Kv3,4, accession number Q63734	100ug	279-Eur	Stressmarq
orb80659	Human GRO-alpha His tag protein CXCL1 Human Recombinant produced in E.coli is a single,non-glycosylated, polypeptide chain containing 94 amino acids (35-107) and having a molecular mass of 10.1 kDa. T	10	154-Eur	Biorb	recombinant
orb80770	Human Adenylate Kinase 2 protein AK2 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 259 amino acids and having a molecular mass of 28.6 kDa. AK2 is fu	2	154-Eur	Biorb	recombinant
orb81609	Hepatitis Virus NS5 Genotype-1b protein The E.coli derived recombinant protein contains the HCV NS5 Genotype1b immunodominant regions, amino acids 2212-2313. For research use only.	100	228-Eur	Biorb	recombinant
orb81608	Hepatitis Virus NS5 Genotype-1a protein The E.coli derived 38 kDa recombinant protein contains the HCV NS5 Genotype1a immunodominant regions, amino acids 2212-2313. For research use only.	100	228-Eur	Biorb	recombinant
SMC-333D	NR2B Antibody Monoclonal, Clone number: S59-20 Host: Mouse, Isotype: IgG2a Immunogen: Fusion protein amino acids 20-271 (N-terminus) of rat NR2B	100ug	279-Eur	Stressmarq
orb80660	Human MIP2 His protein GRO-Beta Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 94 amino acids and having a molecular mass of 10.1 kDa. The GRO-b is fu	2	154-Eur	Biorb	recombinant
orb80961	Human Bcl2 XL GST Tag protein Bcl-XL Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing amino acids 1-210. The Bcl-XL is expressed as GST-Tag fusion protei	2	154-Eur	Biorb	recombinant
orb82766	Human PTH 7-34 protein Recombinant Human Parathyroid Hormone 7-34 is a single non-glycosylated polypeptide chain containing 28 amino acids. less than _pGreater thanPolypeptide hormones secreted by the	1 mg	817-Eur	Biorb	recombinant
orb81127	Human Fascin protein FSCN1 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 513 amino acids (1-493 a.a.) and having a molecular mass of 56.7 kDa. The FSC	5	154-Eur	Biorb	recombinant
orb80334	Human Galectin 8 protein LGALS8 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 337 amino acids (1-317 a.a.) and having a molecular mass of 37.9 kDa. T	2	154-Eur	Biorb	recombinant
orb81393	Human Stathmin Like-3 protein STMN3 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 163 amino acids (39-180 a.a.) and having a molecular mass of 18.9 kD	2	154-Eur	Biorb	recombinant
orb81386	Human Spastic Paraplegia 21 protein SPG21 produced in E.coli is a single, non-glycosylated polypeptide chain containing 328 amino acids (1-308 a.a.) and having a molecular mass of 94.4 kDa.SPG21 is ex	5	154-Eur	Biorb	recombinant
orb81381	Human SRY (sex determining region Y)-box 2 protein SOX2 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 208 amino acids (1-200 a.a.) and having a molec	5	154-Eur	Biorb	recombinant
orb90310	Human Uroporphyrinogen Decarboxylase protein UROD Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 387 amino acids (1-367 a.a.) and having a molecular ma	5	154-Eur	Biorb	recombinant
orb81033	Human Cbp_p300-Interacting Transactivator 2 protein CITED2 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 278 amino acids (1-270 a.a.) and having a mo	5	154-Eur	Biorb	recombinant
SMC-359D	Kv2.2 Antibody Monoclonal, Clone number: S37-89 Host: Mouse, Isotype: IgG2a Immunogen: Fusion protein amino acids 1-61 of rat kv2.2, accession number Q63099.	100ug	279-Eur	Stressmarq
bs-0348P	Peptides: G Protein(Guanine nucleotide-binding regulatory protein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0166P	Peptides: NKR ； Neurokin B receptor (Neuromedin K receptor; NK-4 receptor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2179P	Peptides: AACT protein(Alpha chymotrypsin protein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
SMC-431D	SUR2A Antibody Monoclonal, Clone number: S319A-14 Host: Mouse, Isotype: IgG2A Immunogen: Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mo	100ug	279-Eur	Stressmarq
27-955	C4BPB is a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. A single, unique beta-chain encoded by this gene asse	0.05 mg	632-Eur	Prosci	Proteins
orb81178	Human Killer Cell Immunoglobulin-Like Receptor, Domains Short Cytoplasmic Tail 4 protein Recombinant KIR2DS4 produced in E.coli is a single, non-glycosylated polypeptide chain containing amino acids 1	5	154-Eur	Biorb	recombinant
orb81176	Human Killer Cell Immunoglobulin-Like Receptor, Domains Long Cytoplasmic Tail 1 protein KIR2DL1 Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing amino acids 1-	5	154-Eur	Biorb	recombinant
orb81177	Human Killer Cell Immunoglobulin-Like Receptor, Domains Long Cytoplasmic Tail 3 protein Recombinant KIR2DL3 produced in E.coli is a single, non-glycosylated polypeptide chain containing amino acids 1-	5	154-Eur	Biorb	recombinant
SMC-435D	Alpha-2C Adrenergic Receptor Antibody Monoclonal, Clone number: S330A-80 Host: Mouse, Isotype: IgG1 Immunogen: Synthetic peptide amino acids 442-462 (QDFRRSFKHILFRRRRRGFRQ, cytoplasmic C-terminus) of	100ug	279-Eur	Stressmarq
SMC-433D	Alpha-2C Adrenergic Receptor Antibody Monoclonal, Clone number: S330A-51 Host: Mouse, Isotype: IgG2A Immunogen: Synthetic peptide amino acids 442-462 (QDFRRSFKHILFRRRRRGFRQ, cytoplasmic C-terminus) of	100ug	279-Eur	Stressmarq
bs-2045P	Peptides: Alpha-AF_ Alpha-Afa(alpha-L-arabinofuranosidase) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
orb80744	Human Nafarelin protein Nafarelin is decapeptide containing amino acids Glu-His-Trp-Ser-Ala-Leu-Arg-Pro.Nafarelin is purified by proprietary chromatographic techniques. For research use only.	8 mg	359-Eur	Biorb	human
orb80645	Rat VEGF-C (152) protein VEGF -C 152 Rat Recombinant contains 152 amino acids residues and was fused to His-tag (6x His) at the C-terminal end. As result of glycosylation VEGF-C migrates as an 18-24 k	2	154-Eur	Biorb	recombinant
orb81368	Human Mothers Against Decapentaplegic Homolog 4 protein SMAD4 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 572 amino acids (1-552) and having a molec	10	154-Eur	Biorb	recombinant
orb90043	Human Biliverdin Reductase A protein BLVRA Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 295 amino acids (3-296 a.a. and Methionine at N-terminus) an	10	154-Eur	Biorb	elisa
orb80066	Human IL7 protein Human IL7 Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 153 amino acids and having a molecular mass of 17412 Dalton. The IL7 is purified b	2	154-Eur	Biorb	recombinant
orb80771	Human Adenylate Kinase Like 1 protein AK3L1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 259 amino acids (1-223) and having a molecular mass of 29.3	5	154-Eur	Biorb	recombinant
orb80994	Human Calnexin protein CANX Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 462 amino acids (21-481 a.a.) and having a molecular mass of 52.5kDa.The CA	10	154-Eur	Biorb	recombinant
orb90038	Human Argininosuccinate Synthase 1 protein ASS1 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 432 amino acids (1-412 a.a.) and having a molecular mass	2	154-Eur	Biorb	recombinant
25-958	DGAT2L4 is acyltransferase that predominantly esterify long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting that it plays a c	0.05 mg	632-Eur	Prosci
EIAAB12838	3-keto acyl-CoA synthase Elovl3,Cig30,CIN-2,Cold-inducible glycoprotein of 30 kDa,Elongation of very long chain fatty acids protein 3,Elovl3,Mouse,Mus musculus		1164-Eur	EIAab
27-115	The human gene C19orf6 localizes to chromosome 19p13.3. Splice variant membralin-1 is encoded by 11 exons, translating into 620 amino acids. Membralin is a novel tumor-associated marker in ovarian ser	0.05 mg	632-Eur	Prosci	human
orb90036	Human Arginase Type II protein ARG2 Recombinant E.coli produced in E.coli is a single, non-glycosylated polypeptide chain containing 353 amino acids (23-354 a.a.) and having a molecular mass of 38.3 k	2	154-Eur	Biorb	recombinant
orb81367	Human Mothers Against Decapentaplegic Homolog 3 protein SMAD3 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 445 amino acids (1-425) and having a molec	5	154-Eur	Biorb	recombinant
orb80152	Human MIP3 protein MIP-3 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 99 amino acids and having a molecular mass of 11.3kDa. The MIP-3 is purified b	5	154-Eur	Biorb	recombinant
orb80913	Human Annexin A2 protein ANXA2 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 376 amino acids (1-339a.a.) and having a molecular mass of 42.8 kDa. ANX	5	154-Eur	Biorb	recombinant
orb90028	Human Aldehyde Dehydrogenase protein ALDH2 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 501 amino acids (18-517 a.a.) having a molecular mass of 54.5	10	154-Eur	Biorb	recombinant
orb90015	Human Acid Phosphatase-1 protein Recombinant Human ACP1 produced in E.coli is a single, non-glycosylated polypeptide chain containing 178 amino acids (1-158 a.a.) and having a molecular mass of 20.1 k	5	154-Eur	Biorb	recombinant
SMC-300D	CAV1.2, S57-46 Monoclonals AntibodiesS57-46 Fusion protein amino acids 1507-1733 (intracellular carboxyl terminus) of rabbit Cav1.2, accession number P15381	100ug	324-Eur	Stressmarq
orb81206	Human Melanoma Antigen Family A, 4 protein MAGEA4 Recombinant E.coli produced in E.coli is a single, non-glycosylated polypeptide chain containing 337 amino acids (1-317 a.a.) and having a molecular m	5	154-Eur	Biorb	recombinant
orb81229	Human Neutrophil Cytosolic Factor 1 protein NCF1 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 398 amino acids (1-390 a.a.) and having a molecular mas	2	154-Eur	Biorb	recombinant
orb80369	Zebrafish Growth Hormone protein Somatotropin Zebrafish Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 185 amino acids with an additional Ala at the N-termin	100	359-Eur	Biorb	recombinant
orb81355	Human Alpha-1 Antitrypsin protein SERPINA1 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 395 amino acids (25-418) and having a molecular mass of 44.4	5	154-Eur	Biorb	recombinant
orb81437	Human Cardiac Troponin-I protein Recombinant Human TNI produced in E.coli is a single, non-glycosylated, polypeptide chain containing 165 amino acids and having a molecular mass of 24,016 Dalton.The T	10	154-Eur	Biorb	recombinant
orb81239	Human Neuroblastoma RAS Viral Oncogene Homolog protein NRAS Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 186 amino acids (1-186 a.a.) and having a mo	2	154-Eur	Biorb	recombinant
orb81065	Human Diazepam Binding Inhibitor protein DBI Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 107 amino acids (1-87a.a.) and having a molecular mass of	5	154-Eur	Biorb	recombinant
orb81213	Human Multiple Coagulation Factor Deficiency 2 protein MCFD2 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 136 amino acids (27-146 a.a.) and having mo	5	154-Eur	Biorb	recombinant
orb81236	Human Non-Metastatic Cells 1 protein NME1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 152 amino acids (1-152 a.a.) and having a molecular mass of 1	5	154-Eur	Biorb	recombinant
orb80835	Human Non-Metastatic Cells 2 protein NME2 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 152 amino acids (1-152 a.a.) and having a molecular mass of 17	5	154-Eur	Biorb	recombinant
orb80941	Human Bcl2-Associated Athanogene 3 protein BAG3 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 595 amino acids (1-575 a.a.) and having a molecular mass	2	154-Eur	Biorb	recombinant
orb90014	Human Acetyl-Coenzyme acetyltransferase protein ACAT2 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 210 amino acids (1-190 a.a.) and having a molecula	5	154-Eur	Biorb	recombinant
orb90009	Human Acetyl-COA Acyltransferase protein ACAA1 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 419 amino acids (27-424 a.a.) and having a molecular mass	5	154-Eur	Biorb	recombinant
orb80118	Human BCA1 protein CXCL13 Human Recombinant produced in E.coli is a single,non-glycosylated, polypeptide chain containing 87 amino acids and having a molecular mass of 10.3 kDa. The BCA-1 is purified	5	154-Eur	Biorb	recombinant
orb90201	Human 8-Oxoguanine DNA Glycosylase protein OGG1 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 368 amino acids (1-345 a.a.) and having a molecular mass	5	154-Eur	Biorb	recombinant
orb80906	Human Alpha Hemoglobin Stabilizing protein AHSP Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 102 amino acids (1-102 a.a.) and having a molecular mas	10	154-Eur	Biorb	recombinant
orb80986	Human Calmodulin-2 protein Recombinant CALM2 produced in E.coli is a single, non-glycosylated polypeptide chain containing 149 amino acids and having a molecular mass of 16 kDa. CALM2 is purified by c	5	154-Eur	Biorb	recombinant
orb81240	Human Non-T-cell Activation Linker protein NTAL Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 238 amino acids (27-243 a.a.) and having a molecular ma	5	154-Eur	Biorb	recombinant
orb80988	Human Calbindin-2 protein CALB2 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 211 amino acids (1-271 a.a.) and having a molecular mass of 33.7kDa.The	5	154-Eur	Biorb	recombinant
orb80918	Human Annexin A7 protein ANXA-7 Human Recombinant produced in E.coli is non-glycosylated, polypeptide chain containing amino acids (1-466) and having total molecular mass of 53.6 kda. ANXA7 contains T	2	154-Eur	Biorb	recombinant
orb90115	Human Glycerol-3-Phosphate Dehydrogenase protein GPD2 Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 558 amino acids fragment (43-600) corresponding t	2	154-Eur	Biorb	recombinant
orb90146	Human Hypoxanthine-Guanine Phosphoribosyltransferase protein HPRT1 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 238 amino acids (1-218 a.a.) and havi	5	154-Eur	Biorb	recombinant
orb90303	Human UDP-Glucose Dehydrogenase protein UGDH Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 533 amino acids (1-494 a.a.) and having a molecular mass of	2	154-Eur	Biorb	recombinant
orb90153	Human Inosine Triphosphatase protein ITPA Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 215 amino acids (1-194 a.a.) and having a molecular mass of 23	5	154-Eur	Biorb	recombinant
orb90103	Human UDP-Galactose-4-Epimerase protein GALE Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 368 amino acids (1-348 a.a.) and having a molecular mass of	5	154-Eur	Biorb	recombinant
orb90302	Human Ubiquitin-Conjugating Enzyme E2 Variant 2 protein UBE2V2 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 165 amino acids (1-145 a.a.) and having a	5	154-Eur	Biorb	recombinant
orb90166	Human Lactate Dehydrogenase A protein LDHA Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 352 amino acids (1-332 a.a.) and having a molecular mass of 3	5	154-Eur	Biorb	recombinant
orb90240	Human Protein Phosphatase-1, Regulatory Subunit-14A protein Recombinant PPP1R14A produced in E.coli is a single, non-glycosylated polypeptide chain containing 167 amino acids and having a molecular ma	5	154-Eur	Biorb	recombinant
orb90168	Human Lactate Dehydrogenase B protein LDHB Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 354 amino acids (1-334 a.a.) and having a molecular mass of 3	5	154-Eur	Biorb	recombinant
orb80057	Human IL3 protein Human IL3 Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 133 amino acids and having a molecular mass of 15000 Dalton. The IL3 is purified b	2	154-Eur	Biorb	recombinant
orb90143	Human Heme Oxygenase 2 protein HMOX2 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 264 amino acids (1-264 a.a.) and having a molecular mass of 30.5 k	5	154-Eur	Biorb	recombinant
orb90123	Human Guanosine Monophosphate Reductase 2 protein GMPR2 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 368 amino acids (1-348 a.a.) and having a molec	2	154-Eur	Biorb	recombinant
orb81483	Human Crystallin Beta B1 protein CRYBB1 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 260 amino acids (1-252 a.a.) and having a molecular mass of 29.1	5	154-Eur	Biorb	recombinant
orb81026	Human Cofilin-1 protein Cofilin1 Human Recombinant (1-166 a.a.) fused to N-terminal His-Tag produced in E.coli is a single, non-glycosylated polypeptide chain containing total of 186 amino acids and h	5	154-Eur	Biorb	recombinant
orb90130	Mouse Glutathione S-Transferase M1 protein GSTM1 Mouse Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 218 amino acids and having a molecular mass of 25.9 kD	10	154-Eur	Biorb	recombinant
orb80889	Human Creatine Kinase Brain His tag protein CKB Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 401 amino acids (1-381 a.a.) and having a molecular mass	5	154-Eur	Biorb	recombinant
orb90114	Human Glycerol-3-Phosphate Dehydrogenase protein GPD1 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 349 amino acids (1-349 a.a.) and having a molecula	5	154-Eur	Biorb	recombinant
orb90127	Human Glyoxylate Reductase_Hydroxypyruvate Reductase protein GRHPR Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 348 amino acids (1-328 a.a.) and havi	5	154-Eur	Biorb	recombinant
orb80977	Human Complement C1q TNF-Related protein C1QTNF3 Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 234 amino acids and having a molecular mass of 25.4 kD	2	154-Eur	Biorb	recombinant
orb80939	Human Brain and Acute Leukemia, Cytoplasmatic protein BAALC Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 165 amino acids (1-145 a.a.) and having a mo	2	154-Eur	Biorb	recombinant
orb90301	Human Ubiquitin Conjugating Enzyme E2T protein UBE2T Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 205 amino acids (1-197 a.a.) and having a molecula	5	154-Eur	Biorb	recombinant
orb90177	Human Malate Dehydrogenase 1 protein MDH1 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 342 amino acids (1-334 a.a.) and having a molecular mass of 37	5	154-Eur	Biorb	recombinant
orb90260	Human Ribonucleotide Reductase M2 protein RRM2 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 409 amino acids (1-389 a.a.) and having a molecular mass	5	154-Eur	Biorb	recombinant
orb90213	Human Pyridoxal Phosphatase protein PDXP Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 316 amino acids (1-296 a.a.) and having a molecular mass of 33.	2	154-Eur	Biorb	elisa
orb80425	Human IL5 protein Human IL5 Recombinant produced in E.coli is dimeric, non-glycosylated polypeptide chain containing 132 amino acids and having a molecular mass of 26522.84 Dalton.The IL-5 is purified	2	154-Eur	Biorb	recombinant
orb90214	Human Peroxisomal D3,D2-Enoyl-CoA Isomerase protein PECI Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 384 amino acids (1-364 a.a.) and having a molec	5	154-Eur	Biorb	recombinant
orb90211	Human Disulfide Isomerase A3 protein PDIA3 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 518 amino acids (25-505 a.a.) and having molecular wieght of	5	154-Eur	Biorb	recombinant
orb80420	Human IL3 Sf9 protein Human IL3 Recombinant produced in insect cells is a single, glycosylated polypeptide chain containing 133 amino acids and having a molecular mass of 15000 Dalton. The IL3 CSF is	2	154-Eur	Biorb	recombinant
orb90255	Human Prostaglandin Synthase 3 protein Recombinant Human PTGES3 produced in E.coli is a single,non-glycosylated polypeptide chain containing 160 amino acids (1-160 a.a.) and having a molecular mass of	5	154-Eur	Biorb	recombinant
orb90216	Human Phosphoglycerate Mutase 1 protein PGAM1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 274 amino acids (1-254 a.a.) and having a molecular mass	5	154-Eur	Biorb	recombinant
orb80975	Human Complement Component 1 protein C1QBP Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 210 amino acids and having a molecular mass of 23.9 kDa. For	5	154-Eur	Biorb	recombinant
orb90195	Human Nicotinamide Nucleotide Adenylyltransferase 1 protein NMNAT1 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 315 amino acids (1-279 a.a.) and havi	5	154-Eur	Biorb	recombinant
orb90269	Human Sorbitol Dehydrogenase protein SORD Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 377 amino acids (1-357 a.a.) and having a molecular mass of 4	5	154-Eur	Biorb	recombinant
orb90179	Human Malate Dehydrogenase 2 protein MDH2 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 335 amino acids (25-338 a.a.) and having a molecular mass of 3	2	154-Eur	Biorb	recombinant
orb90299	Human Ubiquitin Conjugating Enzyme E2L 6 protein UBE2L6 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 188 amino acids (1-152 a.a.) having a molecular	5	154-Eur	Biorb	recombinant
orb90292	Human Ubiquitin Conjugating Enzyme E2A protein UBE2A Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 172 amino acids (1-152 a.a.) and having a molecula	5	154-Eur	Biorb	recombinant
orb90182	Human Methylmalonic Aciduria Type B protein MMAB Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 239 amino acids (33-250 a.a.) and having a molecular ma	5	154-Eur	Biorb	recombinant
orb90180	Human Mitochondrial Trans-2-Enoyl-CoA Reductase protein MECR Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 341 amino acids (54-373 a.a.) and having a	2	154-Eur	Biorb	recombinant
orb90290	Human Thioredoxin Reductase 1 protein TXNRD1 Human Recombinant produced in E.coli is a single, non-glycosylated,polypeptide chain containing 508 amino acids (161-647 a.a.) and having a molecular mass	5	154-Eur	Biorb	recombinant
orb90280	Human Thiamine Triphosphatase protein Recombinant Human THTPA produced in E.coli is a single, non-glycosylated polypeptide chain containing 250 amino acids (1-230 a.a.) and having a molecular mass of	5	154-Eur	Biorb	recombinant
orb90273	Human Sulfotransferase Family, Cytosolic, 2B, Member 1 protein SULT2B1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 365 amino acids (1-365 a.a.) and	5	154-Eur	Biorb	recombinant
orb80061	Human IL4 protein Human IL4 Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 130 amino acids and having a molecular mass of 15000 Dalton. The IL-4 is purified	5	154-Eur	Biorb	recombinant
orb90137	Human Glutathione S-Transferase Zeta-1 protein GSTZ1 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 236 amino acids (1-216 a.a.) and having a molecular	5	154-Eur	Biorb	recombinant
orb80919	Human Annexin A8 protein ANXA8 Human Recombinant produced in E.coli is signle, non-glycosylated, polypeptide chain containing 347 amino acids (1-327 a.a.)and having total molecular mass of 39 kDa. ANX	5	154-Eur	Biorb	recombinant
orb80063	Human IL6 protein Human IL6 Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 184 amino acids and having a molecular mass of 21000 Dalton. The IL6 is purified b	5	154-Eur	Biorb	recombinant
orb90069	Human Dicarbonyl_L-Xylulose Reductase protein DCXR Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 264 amino acids (1-244 a.a.) and having a molecular m	5	154-Eur	Biorb	recombinant
orb90083	Human Enoyl CoA Hydratase, Short chain, 1, Mitochondrial protein ECHS1 produced in E.coli is a single, non-glycosylated polypeptide chain containing 284 amino acids (28-290 a.a.) and having a molecula	5	154-Eur	Biorb	recombinant
orb80384	Human Interferon-alpha 1 protein IFNA1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 167 amino acids (24-189) and having a molecular mass of 19.5 kDa	5	154-Eur	Biorb	recombinant
orb90274	Human Estrogen Sulfotransferase protein Recombinant Human SULT1E1 produced in E.coli is a single, non-glycosylated polypeptide chain containing 302 amino acids (1-294 a.a.) and having a molecular mass	5	154-Eur	Biorb	recombinant
orb80985	Human Calbindin-1 protein CALB1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 261 amino acids (1-261 a.a.) and having a molecular mass of 30kDa.The C	10	154-Eur	Biorb	recombinant
CSB-EL007619HU	Human elongation of very long chain fatty acids (FEN1_Elo2, SUR4_Elo3, yeast)-like 1 (ELOVL1) ELISA kit, Species Human, Sample Type serum, plasma	96T	913-Eur	Cusabio	elisa
CSB-EL007620HU	Human elongation of very long chain fatty acids (FEN1_Elo2, SUR4_Elo3, yeast)-like 2 (ELOVL2) ELISA kit, Species Human, Sample Type serum, plasma	96T	913-Eur	Cusabio	elisa
orb80920	Human Annexin A9 protein ANXA-9 Human Recombinant produced in E.coli is non-glycosylated, polypeptide chain containing amino acids (1-338) and having total molecular mass of 38.9 kDa. ANXA9 contains T	2	154-Eur	Biorb	recombinant
orb80395	Human Interferon Regulatory Factor-3 protein IRF-3 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 111 amino acids (1-112) and having a molecular mass	5	154-Eur	Biorb	recombinant
orb80663	Human IL8 (1-72) protein IL8 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 72 amino acids and having a molecular mass of 8452 Dalton. The IL-8 is puri	5	154-Eur	Biorb	recombinant
orb80924	Human ADP-Ribosylation Factor 1 protein ARF1 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 201 amino acids (1-181 a.a.) and having a molecular mass of	5	154-Eur	Biorb	recombinant
orb90053	Human Carbonyl Reductase-1 protein Recombinant Human CBR1 produced in E.coli is a single, non-glycosylated polypeptide chain containing 277 amino acids (1-277 a.a) and having a molecular mass of 30 kD	5	154-Eur	Biorb	recombinant
orb80137	Human IP-10 protein IP-10 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 77 amino acids and having a molecular mass of 8516 Dalton. The IP-10 is purif	5	154-Eur	Biorb	recombinant
orb90057	Human Catechol-O-Methyltransferase protein COMT Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 221 amino acids (51-271 a.a.) having a molecular mass of	2	154-Eur	Biorb	recombinant
orb80665	Human IL8 (1-77) protein IL8 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 77 amino acids and having a molecular mass of 8904 Dalton. The IL-8 is puri	5	154-Eur	Biorb	recombinant
orb81030	Human Chromogranin B protein CHGB Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 677 amino acids (21-677 a.a.) and having a molecular mass of 78.4kDa.	2	154-Eur	Biorb	recombinant
orb80129	Mouse GRO_KC protein KC Mouse Recombinant also known as N51 and GRO1 produced in E.coli is a single,non-glycosylated, polypeptide chain containing 77 amino acids and having a molecular mass of approxi	5	154-Eur	Biorb	recombinant
orb90068	Human dCMP Deaminase protein DCTD Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 198 amino acids (1-178 a.a.) and having a molecular mass of 22.1 kDa.	5	154-Eur	Biorb	recombinant
CSB-EL007621HU	Human elongation of very long chain fatty acids (FEN1_Elo2, SUR4_Elo3, yeast)-like 3 (ELOVL3) ELISA kit, Species Human, Sample Type serum, plasma	96T	913-Eur	Cusabio	elisa
orb90101	Human Fumarate Hydratase protein Fumarase Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 467 amino acids (44-510) and having a molecular mass of 50.2 k	10	154-Eur	Biorb	recombinant
orb81054	Human C-Terminal Binding Protein 1 protein CTBP1 produced in E.coli is a single,non-glycosylated polypeptide chain containing 440 amino acids (1-400 a.a.) and having a molecular mass of 47.5 kDa. CTBP	5	154-Eur	Biorb	recombinant
orb80968	Human Baculoviral IAP Repeat-Containing 7 protein BIRC7 Human Recombinant fused to N-terminal His-Tag produced in E.coli is a single, non-glycosylated polypeptide chain containing 318 amino acids and	5	154-Eur	Biorb	recombinant
CSB-EL007620MO	Mouse elongation of very long chain fatty acids (FEN1_Elo2, SUR4_Elo3, yeast)-like 2 (ELOVL2) ELISA kit, Species Mouse, Sample Type serum, plasma	96T	913-Eur	Cusabio	elisa
CSB-EL007621MO	Mouse elongation of very long chain fatty acids (FEN1_Elo2, SUR4_Elo3, yeast)-like 3 (ELOVL3) ELISA kit, Species Mouse, Sample Type serum, plasma	96T	913-Eur	Cusabio	elisa
orb90107	Human Glutaryl-Coenzyme Dehydrogenase protein GCDH Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 415 amino acids (45-438 a.a.) and having a molecular	2	154-Eur	Biorb	recombinant
orb90128	Human Glutathione S-Transferase Alpha 1 protein GSTA1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 222 amino acids (1-222 a.a.) and having a molecul	10	154-Eur	Biorb	recombinant
orb90129	Human Glutathione S-Transferase Kappa 1 protein GSTK1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 226 amino acids (1-226 a.a.) and having a molecul	10	154-Eur	Biorb	recombinant
CSB-EL007622MO	Mouse elongation of very long chain fatty acids (FEN1_Elo2, SUR4_Elo3, yeast)-like 4 (ELOVL4) ELISA kit, Species Mouse, Sample Type serum, plasma	96T	913-Eur	Cusabio	elisa
CSB-EL007619MO	Mouse elongation of very long chain fatty acids (FEN1_Elo2, SUR4_Elo3, yeast)-like 1 (ELOVL1) ELISA kit, Species Mouse, Sample Type serum, plasma	96T	913-Eur	Cusabio	elisa
CSB-EL007622RH	Monkey elongation of very long chain fatty acids (FEN1_Elo2, SUR4_Elo3, yeast)-like 4 (ELOVL4) ELISA kit, Species Monkey, Sample Type serum, plasma	96T	913-Eur	Cusabio	elisa
orb80966	Human Bridging Integrator 1 protein BIN1 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 459 amino acids (1-439 a.a.) and having a molecular mass of 50.	5	154-Eur	Biorb	recombinant
CSB-EL007622HU	Human elongation of very long chain fatty acids (FEN1_Elo2, SUR4_Elo3, yeast)-like 4 (ELOVL4) ELISA kit, Species Human, Sample Type serum, plasma	96T	913-Eur	Cusabio	elisa
orb90104	Human Galactose Mutarotase protein GALM Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 362 amino acids (1-342 a.a.) and having a molecular mass of 39.9	5	154-Eur	Biorb	recombinant
orb90254	Human Gankyrin protein PSMD10 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 226 amino acids and having a molecular mass of 24.4 kDa. For research use	5	154-Eur	Biorb	recombinant
orb90108	Human Geranylgeranyl Diphosphate Synthase 1 protein GGPS1 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 320 amino acids (1-300 a.a.) and having a mole	5	154-Eur	Biorb	recombinant
orb90124	Human Glucosamine-6-Phosphate Deaminase 1 protein GNPDA1 Recombinant Human produced in E.coli is a single, non-glycosylated, polypeptide chain containing 309 amino acids (1-289) and having a molecular	5	154-Eur	Biorb	recombinant
orb90112	Human Glutamic-Oxaloacetic Transaminase 1 protein GOT1 Recombinant E.coli produced in E.coli is a single, non-glycosylated polypeptide chain containing 433 amino acids (1-413 a.a.) and having a molecu	5	154-Eur	Biorb	recombinant
orb90110	Human Glutamine Synthetase protein GLUL Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 393 amino acids (1-373 a.a.) and having a molecular mass of 44.2	5	154-Eur	Biorb	recombinant
orb90121	Human Glutaredoxin 3 protein GLRX3 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 355 amino acids (1-335 a.a.) and having a molecular mass of 39.6kDa.	5	154-Eur	Biorb	recombinant
orb90133	Human Glutathione S-Transferase Omega 1 protein GSTO1 Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 241 amino acids fragment (1-241) having Mw of 32.	2	154-Eur	Biorb	recombinant
orb80876	Human Thiopurine S-methyltransferase protein TPMT Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 245 amino acids (1-245) and having a molecular mass o	5	154-Eur	Biorb	recombinant
orb81169	Human Hydroxysteroid (17-beta) Dehydrogenase 10 protein HSD17B10 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 271 amino acids (1-186 a.a.) and havin	5	154-Eur	Biorb	recombinant
orb81364	Human Secretory Leukocyte Peptidase Inhibitor protein SLPI Recombinant E.coli produced in E.coli is a single, non-glycosylated polypeptide chain containing 128 amino acids (26-132 a.a.) and having a m	2	154-Eur	Biorb	recombinant
orb81352	Human Secretagogin protein SCGN Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 296 amino acids (1-276 a.a.) and having a molecular mass of 34.2kDa. SCG	2	154-Eur	Biorb	elisa
orb80376	Human GMF Beta His Tag protein GMFB Human Recombinant produced in E.coli is signle, non-glycosylated, polypeptide chain containing 162 amino acids (1-142 a.a.)and having total molecular mass of 18.8 k	5	154-Eur	Biorb	recombinant
orb81348	HumanS100 Calcium Binding Protein Z His tag protein S100Z Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 119 amino acids (1-99 a.a.) and having a molec	5	154-Eur	Biorb	recombinant
orb80265	Canine Apoliprotein HEK protein Clusterin Canine Recombinant produced in HEK293 cells is a single, glycosylated, Polypeptide chain containing 436 amino acids and having a molecular mass of 50.72 kDa.	2	154-Eur	Biorb	recombinant
orb81520	Human HSP70 Interacting protein Recombinant Human ST13 produced in E.coli is a single,non-glycosylated polypeptide chain containing 369 amino acids (12-369 a.a.) and having a molecular mass of 41.3 kD	10	154-Eur	Biorb	recombinant
orb81165	Human Homer Homolog-1 protein Recombinant Human HOMER1 produced in E.coli is a single, non-glycosylated polypeptide chain containing 391 amino acids (1-354 a.a) and having a molecular mass of 44.5 kDa	5	154-Eur	Biorb	recombinant
orb80412	Mouse IL1 Receptor Antagonist protein IL1 ra Mouse Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 153 amino acids and having a molecular mass of 17.4kDa. The	10	154-Eur	Biorb	recombinant
orb81143	Human GLI Pathogenesis-Related 2 protein GLIPR2 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 174 amino acids (1-154) having a molecular mass of 19.3	5	154-Eur	Biorb	recombinant
orb81056	Cyclosporin-A protein Cyclosporin is cyclic polypeptide immunosuppressant agent consisting of 11 amino acids and having molecular weight of 1202.64. It is produced as metabolite by the fungus species	1 g	154-Eur	Biorb
orb80049	Mouse IL1 alpha protein IL1A Mouse Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 156 amino acids and having a molecular mass of 18 kDa. The IL-1A is purifi	2	154-Eur	Biorb	recombinant
SMC-414D	Ankyrin-B Antibody Monoclonal, Clone number: S105-17 Host: Mouse, Isotype: IgG2A Immunogen: Synthetic peptide amino acids 203-496 of human Ankyrin-B	100ug	279-Eur	Stressmarq
orb81079	Human Eukaryotic Translation Initiation Factor 1 protein EIF1 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 150 amino acids (1-113 a.a.) and having mo	2	154-Eur	Biorb	recombinant
orb80107	Human TNF-alpha protein TNF-a Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 158 amino acids and having a molecular mass of 17483.77 Dalton. The TNF-a	10	154-Eur	Biorb	recombinant
orb81158	Human Hypoxia-Inducible Factor-1 Alpha His Tag protein HIF1A Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 231 amino acids (576-785 a.a.) and having a	2	154-Eur	Biorb	recombinant
orb80613	Human TGF Beta 3 protein TGF-b3 Human Recombinant produced in E.coli is disulfide-linked homodimeric, non-glycosylated, polypeptide chain containing 112 amino acids and having a molecular mass of 25,4	2	154-Eur	Biorb	recombinant
SMC-397D	VGlut3 Antibody Monoclonal, Clone number: S34-34 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 546-588 (cytoplasmic C-terminus) of rat VGlut3.	100ug	279-Eur	Stressmarq
orb81362	Human Sertuin-6 protein SIRT6 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 375 amino acids (1-355 a.a.) and having a molecular mass of 41 kDa. Recomb	2	154-Eur	Biorb	recombinant
orb80321	Bovine FGF 21 protein Fibroblast Growth Factor -21 Bovine Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 182 amino acids, having molecular weight of 19.5 kD	5	154-Eur	Biorb	recombinant
orb80064	Mouse IL6 protein IL6 Mouse Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 187 amino acids and having a molecular mass of 21709 Dalton. The IL-6 is purified	2	154-Eur	Biorb	recombinant
orb81413	Human Testis Derived Transcript protein TES Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 441amino acids (1-421 a.a.) and having a molecular mass of 5	2	154-Eur	Biorb	recombinant
orb80062	Mouse IL4 protein IL4 Mouse Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 120 amino acids and having a molecular mass of 13500 Dalton. The IL-4 is purified	5	154-Eur	Biorb	recombinant
SMC-400D	Ankyrin B Antibody Monoclonal, Clone number: S105-13 Host: Mouse, Isotype: IgG1 Immunogen: Synthetic peptide amino acids 203-496 of human Ankyrin-B	100ug	279-Eur	Stressmarq
orb81149	Human General Transcription Factor IIB protein GTF2B Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 336 amino acids (1-316 a.a.) and having a molecula	5	154-Eur	Biorb	recombinant
orb80058	Mouse IL3 protein IL3 mouse Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 135 amino acids and having a molecular mass of 15100 Dalton. The IL-3 is purified	2	154-Eur	Biorb	recombinant
orb80614	Human TGF Beta 3 CHO protein TGF-b Human Recombinant produced in CHO is disulfide-linked homodimeric, glycosylated, polypeptide chain containing 112 amino acids and having a molecular mass of 25kDa. T	2	154-Eur	Biorb	recombinant
orb80309	Human FGF basic Sf9 protein FGF 2 Human Recombinant (FGF-2) produced in Sf9 insect cells is a single, glycosylated, polypeptide chain containing 155 amino acids and having a molecular mass of 17353 Da	2	154-Eur	Biorb	recombinant
orb80084	Mouse IL33 protein Interleukin33 Mouse recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 158 amino acids and having a molecular mass of 17.5 kDa. For research	2	154-Eur	Biorb	recombinant
orb80022	Human FGF basic protein FGF 2 Human Recombinant (FGF-2) produced in E.coli is a single, non-glycosylated, polypeptide chain containing 155 amino acids and having a molecular mass of 17353 Dalton.The F	10	154-Eur	Biorb	recombinant
orb80056	Mouse IL2 protein IL2 Mouse Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 149 amino acids and having a molecular mass of 17231 Dalton. The IL-2 is purified	5	154-Eur	Biorb	recombinant
orb80306	Human FGF acidic Sf9 protein FGF 1 Human Recombinant (FGF-1) produced in Sf9 insect cells is a single, glycosylated, polypeptide chain containing 140 amino acids and having a molecular mass of 15803 D	2	154-Eur	Biorb	recombinant
orb80537	Human Osteoclast Stimulating Factor-1 protein OSTF1 Human Recombinant produced in E.coli is monomeric, non-glycosylated, polypeptide chain containing 222 amino acids (1-214) and having a molecular mas	10	154-Eur	Biorb	recombinant
orb80603	Human Osteopontin protein Secreted Phosphoprotein-1 Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 321 amino acids fragment (17-314) and having total	2	154-Eur	Biorb	recombinant
orb81081	Human Eukaryotic Translation Initiation Factor 4E protein EIF4E Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 237 amino acids (1-217 a.a.) and having	2	154-Eur	Biorb	recombinant
orb80821	Human Hexokinase-2 protein HK2 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain fused to His tag at the N-terminal encoding the sequence of 937 amino acids and hav	2	154-Eur	Biorb	recombinant
orb80820	Human Hexokinase-1 protein HK1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain fused to His tag at the N-terminal encoding the sequence of 937 amino acids and hav	2	154-Eur	Biorb	recombinant
orb81475	Human within BCGN Homolog protein WIBG Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 212 amino acids (1-204 a.a.) and having a molecular mass of 23.7	2	154-Eur	Biorb	recombinant
orb81474	Human WD Repeat Domain 5 protein WDR5 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 354 amino acids (1-334 a.a.) and having a molecular mass of 38.8 k	5	154-Eur	Biorb	recombinant
A2133-10G	Agarose T6, high resolution, high gel strength (1.5%) >2000 g_cm2. Ideal for small nucleic acids and PCR products. This product is specially designed for analysis of DNA fragments less than 1,000 bp.	10G	114-Eur	Biomatic
orb81156	Human Hexamethylene Bis-Acetamide Inducible 1 protein HEXIM1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 396 amino acids (1-359a.a.) and having a m	2	154-Eur	Biorb	elisa
A2133-25G	Agarose T6, high resolution, high gel strength (1.5%) >2000 g_cm2. Ideal for small nucleic acids and PCR products. This product is specially designed for analysis of DNA fragments less than 1,000 bp.	25G	192-Eur	Biomatic
orb81326	Human Related RAS Viral (r-ras) Oncogene Homolog protein RRAS Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 235 amino acids (1-215 a.a.) and having a	2	154-Eur	Biorb	recombinant
orb81316	Green Fluorescent protein rGFP Aequorea victoria produced in E.coli is a single, non-glycosylated polypeptide chain containing 238 amino acids (1-238 a.a.) and having a molecular mass of 26.8 kDa.rGFP	10	154-Eur	Biorb	recombinant
orb81270	Human Profilin 1 protein PFN1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 140 amino acids (1-140 a.a.) and having a molecular mass of 15kDa.The PFN	10	154-Eur	Biorb	recombinant
orb80136	Human HCC-1 protein HCC-1 Human Recombinant produced in E.coli is a single,non-glycosylated, polypeptide chain containing 72 amino acids and having a molecular mass of 8411 Dalton. The HCC-1 is purifi	2	154-Eur	Biorb	recombinant
orb80811	Human VEGF receptor-1 D1-4 protein Soluble FLT1 D1-4 Human Recombinant produced in baculovirus is monomeric, glycosylated, polypeptide containing 457 amino acids and having a molecular mass of 55 kDa.	2	154-Eur	Biorb	recombinant
orb80812	Human VEGF receptor-1 D1-5 protein Soluble FLT1 D1-5 Human Recombinant produced in baculovirus is monomeric, glycosylated, polypeptide containing 562 amino acids and having a molecular mass of 70 kDa.	2	154-Eur	Biorb	recombinant
orb81498	Human GroES (HSP10) protein Recombinant GroES produced in E.coli is a single, non-glycosylated polypeptide chain containing 102 amino acids and having a molecular mass of 10 kDa. For research use only	5	154-Eur	Biorb	recombinant
orb81297	Human RAB Interacting Factor protein RABIF Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 143 amino acids (1-123 a.a.) and having a molecular mass of	2	154-Eur	Biorb	recombinant
orb80822	Human Hexokinase-3 protein HK-3 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain fused to His tag at the N-terminal encoding the sequence of 943 amino acids and ha	2	154-Eur	Biorb	recombinant
SPC-317D	Hsp90C (Plant) Antibody Polyclonal Host: Rabbit Immunogen: C-terminal238 amino acids of Hsp90C expressed with N- and C-terminal hexahistidine tags in E.coli, purified with Ni-NTA.	100ul	292-Eur	Stressmarq
orb80320	Mouse FGF 21 His tag protein Fibroblast Growth Factor -21 Mouse Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 192 amino acids and having a molecular mass o	2	154-Eur	Biorb	recombinant
orb80535	Human Osteoprotegerin His tag protein Recombinant Human OCIF produced in E.coli cells is a single, non-glycosylated, polypeptide chain containing amino acids 201-401 and having a molecular mass of 31	10	154-Eur	Biorb	recombinant
orb80305	Mouse Endoglin protein CD105 Mouse Recombinant extracellular domain produced in baculovirus is homodimeric, glycosylated, Polypeptide containing 581 amino acids and having a molecular mass of 61 kDa b	2	154-Eur	Biorb	recombinant
orb80014	Mouse EGF protein EGF Mouse Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 53 amino acids including intramolecular disulfide-bonds and having a molecular ma	100	154-Eur	Biorb	recombinant
orb81416	Human Transforming Growth Factor Beta Induced 182 a.a. protein TGFBI Recombinant Human produced in E.coli is a single, non-glycosylated, polypeptide containing 182 amino acids (502-683) and having a m	10	154-Eur	Biorb	recombinant
orb80807	Human Riboflavin Kinase protein Flavokinase Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 182 amino acids (1-162 a.a.) and having a molecular mass of	5	154-Eur	Biorb	recombinant
orb80837	Human p21 Activated Kinase 4 protein PAK4 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 628 amino acids (1-591 a.a.) and having a molecular mass of 68	5	154-Eur	Biorb	recombinant
orb81322	Human Rho Family GTPase 3 protein RND3 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 261 amino acids (1-241 a.a.) and having a molecular mass of 29.2	5	154-Eur	Biorb	recombinant
orb80105	Human Trefoil Factor-2 protein TFF-2 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 106 amino acids (24-129) and having total molecular mass of 12 kDa	5	154-Eur	Biorb	recombinant
orb81425	Human Tropomyosin-1 protein TPM1 Human Recombinant produced in E.coli is signle, non-glycosylated, polypeptide chain containing 304 amino acids (1-284 a.a.)and having total molecular mass of 35 kDa. T	2	154-Eur	Biorb	recombinant
orb81443	Human Tumor Susceptibility Gene 101 protein TSG101 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 181 amino acids (1-145 a.a.) and having a molecular	2	154-Eur	Biorb	recombinant
orb80841	Human Phosphofructokinase, Muscle protein PFKM Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 800 amino acids (1-780 a.a.) and having a molecular mass	5	154-Eur	Biorb	recombinant
orb80317	Human FGF 19 His Tag protein Fibroblast Growth Factor -19 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 206 amino acids and having a molecular mass o	5	154-Eur	Biorb	recombinant
orb80934	Mouse Alphalpha Synuclein protein SNCA Recombinant Mouse produced in E.coli is a single, non-glycosylated polypeptide chain containing 140 amino acids (1-140 a.a.) and having a molecular mass of 14.4	5	154-Eur	Biorb	recombinant
orb80842	Human Phosphoglycerate Kinase 1 protein PGK1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 437 amino acids (1-417 a.a.) and having a molecular mass o	5	154-Eur	Biorb	recombinant
orb81146	Human Golgi-Associated PDZ and Coiled-Coil Motif Containing protein GOPC Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 198 amino acids (278-454 a.a.)	5	154-Eur	Biorb	recombinant
SMC-396D	MMP9 Antibody Monoclonal, Clone number: S51-82 Host: Mouse, Isotype: IgG2a Immunogen: Fusion protein amino acids 1-708 (full length) of rat MMP9	100ug	279-Eur	Stressmarq
orb81459	Human Synaptobrevin-1 protein VAMP1 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 111 amino acids and having a molecular mass of 11.9 kDa. For researc	20	154-Eur	Biorb	recombinant
orb81375	Human Sorting Nexin 1 protein SNX1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 415 amino acids (146-522 a.a.) and having a molecular mass of 48 kDa	1	154-Eur	Biorb	recombinant
orb80339	Human GDFHis Tag protein GDF5 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 141 amino acids (382-501 a.a.) and having total molecular mass of 15.8 kD	5	154-Eur	Biorb	recombinant
orb80573	Human Soluble CD4 protein sCD4 Human Recombinant produced in Baculovirus is a single, glycosylated polypeptide chain containing 365 amino acids and having non glycosilated molecular mass of 45 kDa. As	2	154-Eur	Biorb	recombinant
orb80664	Porcine Interleukin-8 (1-72) protein IL8 Porcine Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 72 amino acids and having a molecular mass of 8291 Dalton. Th	2	154-Eur	Biorb	recombinant
orb80466	Rat IL18 protein IL18 Rat Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 158 amino acids and having a molecular mass of 18260 Dalton. The IL-18 is purified b	5	154-Eur	Biorb	recombinant
orb80424	Porcine IL4 protein IL-4 Porcine Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 110 amino acids and having a molecular mass of 12615 Dalton. The IL-4 is puri	2	154-Eur	Biorb	recombinant
orb80416	Porcine IL2 protein Interleukin2 Porcine Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 134 amino acids and having a molecular mass of 15217 Dalton. The IL-2	2	154-Eur	Biorb	recombinant
orb80160	Rat SDF 1 alpha protein Stromal Cell-Derived Factor-1 alpha Rat Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 68 amino acids and having a molecular mass of 7.9 kDa.	2	154-Eur	Biorb	recombinant
orb81378	Human Superoxide Dismutase-2 protein SOD2 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 219 amino acids (25-222 a.a.) and having a molecular mass of	5	154-Eur	Biorb	recombinant
orb80577	Human soluble CD40 Ligand_TRAP His Tag protein sCD40 Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 149 amino acids fragment (113-261) corresponding t	2	154-Eur	Biorb	recombinant
orb81390	Human Stress-Induced-Phosphoprotein 1 protein Recombinant Human STIP1 produced in E.coli is a single, non-glycosylated polypeptide chain containing 563 amino acids (1-543 a.a) and having a molecular m	2	154-Eur	Biorb	recombinant
orb80372	Human GCSF Sf9 protein GM-CSF Human Recombinant produced in insect cells is a single, glycosylated, polypeptide chain containing 127 amino acids (18-144) and having a molecular mass of 14.6kDa. GM-CSF	2	154-Eur	Biorb	recombinant
SMC-360D	Kv2.1 (Extracellular) Antibody Monoclonal, Clone number: S39-25 Host: Mouse, Isotype: IgG2a Immunogen: Synthetic peptide amino acids 11-229 (LPELQSLDEFGQSTDNPQL, extracellular S1-S2 loop) of rat Kv2.1	100ug	279-Eur	Stressmarq
orb82715	Human IL10 protein Interleukin-10 (IL10), also known as Cytokine Synthesis Inhibitory Factor (CSIF), is a single non-glycosylated polypeptide chain containing 161 amino acids. For research use only.	1 mg	2799-Eur	Biorb	human
29-387	Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. FARS2 is a phenylalanine-tRNA synthetase (PheRS) localized to the mitochondrion which consists of a	0.1 mg	496-Eur	Prosci	rna
orb80447	Rat IL15 protein IL15 Rat Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 115 amino acids and having a molecular mass of 13533 Dalton. The IL-15 is purified b	2	154-Eur	Biorb	recombinant
orb80439	Rat IL12 protein IL12 Rat Recombinant produced in Sf9 insect cells is glycosylated disulfide linked heterodimeric polypeptide containing 503 amino acids and having molecular weight of 70 kDa comprised	2	154-Eur	Biorb	recombinant
orb80957	Human Bcl2 Like 2 protein Bcl2L2 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 192 amino acids (1-172 a.a.) and having molecular weight of 20.9kDa. Th	5	154-Eur	Biorb	recombinant
orb80304	Human Endoglin protein CD105 Human Recombinant extracellular domain produced in E.coli is a single, glycosylated, Polypeptide containing 151 amino acids (26-176) and having a molecular mass of 43 kDa.	2	277-Eur	Biorb	recombinant
orb80303	Human Endoglin Sf9 protein CD105 Human Recombinant extracellular domain produced in baculovirus is homodimeric, glycosylated, Polypeptide containing 586 amino acids and having a molecular mass of 61 k	2	154-Eur	Biorb	recombinant
SMC-358D	Kv1.1 (Extracellular) Antibody Monoclonal, Clone number: S36-15 Host: Mouse, Isotype: IgG2b Immunogen: Synthetic peptide amino acids 191-208 (ELKDDKDFTGTIHRIDNTC, extracellular domain) or rat Kv1.1	100ug	279-Eur	Stressmarq
29-553	GNB1L is a G-protein beta-subunit-like polypeptide which is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by	0.1 mg	496-Eur	Prosci
orb80809	Human VEGF receptor-1 D1-3 protein Soluble FLT1 D1-3 Human Recombinant produced in baculovirus is monomeric, glycosylated, polypeptide containing 352 amino acids and having a molecular mass of 45 kDa.	2	154-Eur	Biorb	recombinant
orb80013	Human EGF protein EGF Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 53 amino acids and having a molecular mass of 6222 Dalton.The EGF is purified by	100	154-Eur	Biorb	recombinant
orb81461	Human Synaptobrevin-3 protein VAMP3 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 77 amino acids and having a molecular mass of 8.7 kDa. For research	5	154-Eur	Biorb	recombinant
orb81078	Human Endothelial Differentiation-Related Factor protein EDF1 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 156 amino acids (1-148 a.a.) and having a	5	154-Eur	Biorb	recombinant
orb81403	Human Syndecan-4 protein SDC4 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 128 amino acids (19-145a.a.) and having a molecular mass of 13.9 kDa. SDC	2	154-Eur	Biorb	recombinant
orb80546	Mouse PDGF BB protein Platelet-Derived Growth Factor BB Mouse Recombinant is homodimeric, non-glycosylated, polypeptide chain containing 109 amino acids and having a molecular mass of 25 kDa (12.5 kDa	2	154-Eur	Biorb	recombinant
orb80296	Human EBI3 His tag protein EBI Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 209 amino acids fragment (21-229) having molecular weight of 34kDa and f	2	154-Eur	Biorb	recombinant
orb80109	Mouse TNF-alpha protein TNF-a Mouse Recombinant produced in E.coli is a single, non glycosylated, polypeptide chain containing 157 amino acids and having a molecular mass of 17301.32 Dalton. The TNF-a	5	154-Eur	Biorb	recombinant
27-233	RAB8A is a member of the RAS superfamily which are small GTP_GDP-binding proteins with an average size of 200 amino acids. The RAS-related proteins of the RAB_YPT family may play a role in the transpo	0.05 mg	632-Eur	Prosci	Proteins
orb80875	Mouse TIE-2 Fc Chimera protein Soluble TIE-2 Mouse Recombinant fused with the Fc part of human IgG1 produced in CHO is monomeric, glycosylated, polypeptide containing 740 amino acids and having total	2	154-Eur	Biorb	recombinant
orb80873	Mouse TIE-1 Fc Chimera protein Soluble TIE-1 Mouse Recombinant fused with the Fc part of human IgG1 produced in CHO is monomeric, glycosylated, polypeptide containing 749 amino acids and having total	2	154-Eur	Biorb	recombinant
orb80870	Human Signal Transducer and Activator of Transcription 1 protein STAT1 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 732 amino acids (1-712 a.a.) and	2	154-Eur	Biorb	recombinant
SMC-192D	DUX4 Antibody Monoclonal, Clone number: P2B1 Host: Mouse, Isotype: IgG1 Immunogen: C-terminal 76 amino acids of DUX4 with glutathione-s-transferase (gst) tag	100ug	279-Eur	Stressmarq
orb80662	Human I-309 protein I-309 Human Recombinant produced in E.coli is a single,non-glycosylated, polypeptide chain containing 74 amino acids and having a molecular mass of 8504 Dalton. The I-309 is purifi	2	154-Eur	Biorb	recombinant
SMC-395D	VGlut2 Antibody Monoclonal, Clone number: S29-29 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 501-582 (cytoplasmic C-terminus) of rat VGlut2.	100ug	279-Eur	Stressmarq
orb81241	Mouse Nucleobindin-2 protein NUCB2 Mouse Recombinant fused to N-terminal His-Tag produced in E.coli is a single, non-glycosylated polypeptide chain containing 417 amino acids and having a molecular ma	5	154-Eur	Biorb	recombinant
orb80644	Rat VEGF Related protein VEGF Rat Recombinant contains 129 amino acids residues and was fused to His- tag (6x His) at the C-terminal end. As result of glycosylation VEGF-C migrates as an 18-24 kDa pro	2	154-Eur	Biorb	recombinant
orb90002	Staphylokinase enzyme Staphylokinase Recombinant produced in E.coli is non-glycosylated polypeptide chain containing 136 amino acids and having molecular weight of 15.5 kd.The Staphylokinase is purifi	20	154-Eur	Biorb	recombinant
orb80561	Rat Prolactin protein Prolactin Rat Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 198 amino acids and having a molecular mass of 22.6 kDa. The Prolactin is	10	154-Eur	Biorb	recombinant
orb81771	Measles Virus (399-525) protein The E.coli derived recombinant protein contains the large fusion protein immunodominant regions, 399-525 amino acids. For research use only.	100	228-Eur	Biorb	recombinant
orb90272	Streptokinase protein Streptokinase Recombinant produced in E.coli is non-glycosylated polypeptide chain containing 414 amino acids and having molecular weight of 47 kd.The Streptokinase is purified b	250,000 IU	293-Eur	Biorb	recombinant
SMC-432D	SUR1 and SUR2B Antibody Monoclonal, Clone number: S323A-31 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-termin	100ug	279-Eur	Stressmarq
SMC-434D	GluN2A_NR2A Glutamate Receptor Antibody Monoclonal, Clone number: S327A-38 Host: Mouse, Isotype: IgG2B Immunogen: Fusion protein amino acids 75-325 (extracellular N-terminus) of rat NR2A, accession nu	100ug	279-Eur	Stressmarq
orb81388	Human Advanced Glycosylation End Product-Specific Receptor HEK protein sRAGE Human Recombinant produced in HEK cells is a single, glycosylated, polypeptide chain containing 331 amino acids and having	2	154-Eur	Biorb	recombinant
orb81036	Human Collagen Type IV Alpha Binding protein COL4A3BP Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 290 amino acids (347-598 a.a.) and having a molecu	5	154-Eur	Biorb	recombinant
orb90229	Human Secreted Phospholipase A2-VII protein PLA2G7 Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 420 amino acids fragment (22-441) having total molec	2	154-Eur	Biorb	recombinant
orb81180	Human KISS-1 Metastasis-Suppressor protein KISS1 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 120 amino acids (20-138) and having a molecular mass of	2	154-Eur	Biorb	recombinant
orb80689	Human Platelet Factor-4 protein CXCL4 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 70 amino acids and having a molecular mass of 7.8 kDa. For researc	5	154-Eur	Biorb	recombinant
orb80840	Human Pyruvate Dehydrogenase Kinase Isozyme 1 protein PDK1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 429 amino acids (29-436) and having a molecu	10	154-Eur	Biorb	recombinant
orb81387	Human Advanced Glycosylation End Product-Specific Receptor protein sRAGE Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 134 amino acids and having a m	2	154-Eur	Biorb	recombinant
orb81309	Human Regulator of Calcineurin 1 protein RCAN1 Isoform-b Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 117 amino acids and having a molecular mass of	5	154-Eur	Biorb	recombinant
A2133-100G	Agarose T6, high resolution, high gel strength (1.5%) >2000 g_cm2. Ideal for small nucleic acids and PCR products. This product is specially designed for analysis of DNA fragments less than 1,000 bp.	100G	413-Eur	Biomatic
SMC-398D	Menke's Disease Protein_Cu2+ Transporting Atpase Protein, S60-4 Monoclonals AntibodiesS60_4 Synthetic peptide amino acids 42-61 (cytoplasmic C-terminus) of human Copper- transporting ATPase1	100ug	324-Eur	Stressmarq
SMC-313D	Kv3.1 Antibody Monoclonal, Clone number: S16B-8 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 437-585 (C-terminus) or rat Kv3.1b, accession number NP_036988	100ug	279-Eur	Stressmarq
orb81131	Human Gamma-Aminobutyric Acid Receptor-Associated protein GABARAP Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 137 amino acids (1-117 a.a.) and havi	10	154-Eur	Biorb	recombinant
orb90281	Human Tissue Inhibitor of Metalloprotease 1 protein TIMP1 Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 184 amino acids fragment (24-207) having tota	2	154-Eur	Biorb	recombinant
orb90289	Human Tissue Specific Transplantation Antigen P35B protein TSTA3 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 341 amino acids (1-321 a.a.) and having	5	154-Eur	Biorb	recombinant
orb80936	Human Ataxin-3 protein ATXN3 produced in E.coli is a single, non-glycosylated polypeptide chain containing 370 amino acids (1-370 a.a.) and having a molecular mass of 42.4kDa.ATXN3 is purified by prop	2	154-Eur	Biorb	recombinant
orb90312	Human Tryptophanyl-tRNA Synthetase protein WARS Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 491 amino acids (1-471 a.a.) and having a molecular mass	5	154-Eur	Biorb	recombinant
orb80902	Human Adipose Differentiation-Related protein ADFP Human Recombinant produced in E.coli is signle, non-glycosylated, Polypeptide chain containing 444 amino acids and having a molecular mass of 49 kDa.	2	154-Eur	Biorb	recombinant
orb81319	Human Ras Homolog Gene Family Member C protein RHOC Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 210 amino acids (1-190 a.a.) and having a molecular	2	154-Eur	Biorb	recombinant
orb80031	Human GMCSF protein Granulocyte MCSF Human Recombinant produced in E.coli is a single non-glycosylated polypeptide chain approximately 14.6 kDa, containing 128 amino acids. GM-CSF was initially charac	5	154-Eur	Biorb	recombinant
orb90261	Human SUMO1 Activating Enzyme Subunit 1 protein SAE1 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 378 amino acids (1-346 a.a.) and having a molecular	2	154-Eur	Biorb	recombinant
SMC-332D	CaVbeta2 Antibody Monoclonal, Clone number: S8B-1 Host: Mouse, Isotype: IgG1 Immunogen: Synthetic peptide amino acids 189-205 of rat CavBeta2, accession numer NP_446303	100ug	279-Eur	Stressmarq
orb81018	Human Cell Division Cycle 37 protein CDC37 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 378 amino acids and having a molecular mass of 44.4 kDa. For	5	154-Eur	Biorb	recombinant
SMC-317D	CaVbeta1 Antibody Monoclonal, Clone number: S7-18 Host: Mouse, Isotype: IgG1 Immunogen: Synthetic peptide amino acids 19-34 of rat CavB1, accession number NP_059042	100ug	279-Eur	Stressmarq
orb90266	Human Set7_9 Histone Methyltransferase protein SETD7 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 366 amino acids having a molecular mass of 40.7 kDa	20	154-Eur	Biorb	recombinant
orb90282	Human Tissue Inhibitor of Metalloprotease 1 HEK protein TIMP1 Human Recombinant produced in HEK-293 cells is a single, glycosylated, polypeptide chain containing 184 amino acids with molecular weight	2	154-Eur	Biorb	recombinant
orb80149	Human MIG protein MIG (monokine induced by gamma-interferon Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 103 amino acids and having a molecular mass	5	154-Eur	Biorb	recombinant
orb80808	Human VEGF receptor-1 protein Soluble FLT1 Human Recombinant produced in baculovirus is monomeric, glycosylated, polypeptide containing 688 amino acids and having a molecular mass of 96 kDa. The solub	2	154-Eur	Biorb	elisa
orb81479	Human Activator of HSP90 ATPase-1 protein AHA1 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 320 amino acids (19-337) and having a molecular mass of 3	10	154-Eur	Biorb	recombinant
orb80345	Human GCSF His tag protein Granulocyte Colony Stimulating Factor-His Tag Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 174 amino acids, fragment (31-	2	154-Eur	Biorb	recombinant
SMC-394D	VGlut1 Antibody Monoclonal, Clone number: S28_9 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 493-560 (cytoplasmic C-temrinus) of rat VGlut1	100ug	279-Eur	Stressmarq
orb81214	Human Mediator Complex Subunit 4 protein MED4 produced in E.coli is a single, non-glycosylated polypeptide chain containing 278 amino acids (1-270 a.a.) and having a molecular mass of 30.7kDa. MED4 is	5	154-Eur	Biorb	recombinant
orb81134	Human GADD Gamma protein GADD45G Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 159 amino acids and having a molecular mass of 17.1 kDa. For research u	10	154-Eur	Biorb	recombinant
orb81207	Human Mago-Nashi Homolog protein MAGOH Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 154 amino acids (1-146 a.a.) and having a molecular mass of 18.2	5	154-Eur	Biorb	recombinant
orb81141	Human GIPC PDZ Domain Member 1 protein GIPC1 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 352 amino acids (1-333 a.a.) and having a molecular mass of	2	154-Eur	Biorb	recombinant
orb81034	Human Chloride Intracellular Channel 1 protein CLIC1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 261amino acids (1-241a.a.) and having a molecular	5	154-Eur	Biorb	recombinant
orb81234	Human Nuclear Import Homolog protein NIP7 produced in E.coli is a single, non-glycosylated polypeptide chain containing 188 amino acids (1-180 a.a.) and having a molecular mass of 21.5kDa. NIP7 is fus	5	154-Eur	Biorb	recombinant
orb80138	Human I-TAC (CXCL11) protein I-TAC Human Recombinant (Interferon-inducible T-cell alpha chemoattractant) produced in E.coli is a single, non-glycosylated, polypeptide chain containing 73 amino acids a	5	154-Eur	Biorb	recombinant
SMC-408D	Clcn3 Antibody Monoclonal, Clone number: S258-5 Host: Mouse, Isotype: IgG1 Immunogen: Synthetic peptide amino acids 98-115 (cytoplasmic N-terminus) of rat Clcn3	100ug	279-Eur	Stressmarq
orb81366	Human SMAD Family Member 2 protein SMAD2 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 487 amino acids (1-467) and having a molecular mass of 54.4 kDa	2	154-Eur	Biorb	recombinant
orb81218	Human Myeloid Cell Nuclear Differentiation Antigen protein MNDA Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 427 amino acids (1-407 a.a.) and having	2	154-Eur	Biorb	recombinant
EIAAB12839	3-keto acyl-CoA synthase ELOVL3,CIG30,Cold-inducible glycoprotein of 30 kDa,Elongation of very long chain fatty acids protein 3,ELOVL3,Homo sapiens,Human		1109-Eur	EIAab
orb81119	Human Fragile Histidine Triad protein FHIT Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 155 amino acids (1-147 a.a.) and having a molecular mass of	10	154-Eur	Biorb	recombinant
orb80963	Human BH3 Interacting Domain Death Agonist protein BID Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 195 amino acids and having a molecular mass of 21	2	154-Eur	Biorb	recombinant
orb81231	Human Neuronal Calcium Sensor 1 protein NCS1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 198 amino acids (1-190 a.a.) and having a molecular mass o	5	154-Eur	Biorb	recombinant
orb81132	Human GADD Alpha protein GADD45A produced in E.coli is a single, non-glycosylated polypeptide chain containing 173 amino acids (1-165 a.a.) and having a molecular mass of 19.4kDa. GADD45A is fused to	5	154-Eur	Biorb	recombinant
orb81181	Human Kirsten Rat Sarcoma Viral Oncogene protein KRAS Recombinant human produced in E.coli is a single, non-glycosylated polypeptide chain containing 205 amino acids (1-185 a.a.) and having a molecula	5	154-Eur	Biorb	recombinant
orb81133	Human GADD Beta protein GADD45B Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 160 amino acids and having a molecular mass of 17.8 kDa. For research us	10	154-Eur	Biorb	recombinant
orb80829	Human Lymphatic Endothelial Hyluronan Receptor-1 protein Soluble LYVE1 Human Recombinant fused to GST-tag produced in E.coli is a single, non-glycosylated, polypeptide containing 243-323 amino acids a	2	277-Eur	Biorb	recombinant
SMC-380D	Kv2.1 Antibody Monoclonal, Clone number: S89-34 Host: Mouse, Isotype: IgG1 Immunogen: Synthetic peptide amino acids 837-853 (cytoplamsic Cterminus) of rat KV2.1 (HMLPGGGAHGSTRDQSI), accession number N	100ug	279-Eur	Stressmarq
orb80113	Human Thymic Stromal Lymphopoietin protein TSLP Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 132 amino acids and having a molecular mass of 15 kDa.Th	2	154-Eur	Biorb	recombinant
orb80728	Human Thyrostimulin Alpha protein GPHA2 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 120 amino acids and having total molecular mass of 13.28 kDa. T	2	154-Eur	Biorb	recombinant
orb80602	Human Chromosome 19 Open Reading Frame 10 protein SF20 Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 162 amino acids fragment (33-173) and having tot	10	154-Eur	Biorb	recombinant
orb80974	Human Calcyclin Binding protein CACYBP Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 205 amino acids (1-185a.a.) and having a molecular mass of 23.4	5	154-Eur	Biorb	recombinant
orb80774	Human Aurora Kinase A protein AURKA Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 423 amino acids (1-403) and having a molecular mass of 47.9kDa. AUR	2	154-Eur	Biorb	recombinant
orb81048	Human Caspase and RIP Adapter with Death Domain protein CRADD Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 219 amino acids (1-199) and having a molec	5	154-Eur	Biorb	recombinant
CSB-EL007625HU	Human ELOVL family member 7, elongation of long chain fatty acids (yeast) (ELOVL7) ELISA kit, Species Human, Sample Type serum, plasma	96T	913-Eur	Cusabio	elisa
orb80775	Human Aurora Kinase B protein AURKB Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 364 amino acids (1-344) and having a molecular mass of 41.4kDa. AUR	2	154-Eur	Biorb	recombinant
orb81423	Human Troponin Type 2, Cardiac Isoform 3 protein TNNT2 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 305 amino acids (1-285 a.a.) and having a molecu	5	154-Eur	Biorb	recombinant
orb81408	Human Tubulin Folding Cofactor A protein TBCA Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 108 amino acids (1-108 a.a.) and having a molecular mass	5	154-Eur	Biorb	recombinant
orb80260	Human Apoliprotein J protein The Clusterin Human contains total 454 amino acids and calculated molecular mass of 53058Da. The AA sequence (AA 1-427) is identical to Swiss-Prot-P10909 (AA 23-449, secre	2	154-Eur	Biorb	human
CSB-EL007625BO	Bovine ELOVL family member 7, elongation of long chain fatty acids (yeast) (ELOVL7) ELISA kit, Species Bovine, Sample Type serum, plasma	96T	913-Eur	Cusabio	elisa
orb81329	Human Runt-Related Transcription Factor 3 protein RUNX3 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 155 amino acids (53-186 a.a.) and having a molec	2	154-Eur	Biorb	recombinant
orb80729	Human Thyrostimulin Beta protein GPHB5 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 120 amino acids and having total molecular mass of 13.34 kDa. Th	2	154-Eur	Biorb	recombinant
orb80417	Human Soluble IIL2 Receptor alpha protein IL2R Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 192 amino acids (223-798) corresponding to the mature IL2	5	154-Eur	Biorb	recombinant
orb80028	Human FGF 21 protein Fibroblast Growth Factor -21 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 181 amino acids and an N-terminal Methionin (bold), h	5	154-Eur	Biorb	recombinant
orb80620	Human TNF-beta protein TNF-b Human Recombinant (Lymphotoxin) produced in E.coli is a single, non-glycosylated, polypeptide chain containing 172 amino acids and having a molecular mass of 18645 Dalton.	5	154-Eur	Biorb	recombinant
orb80624	Human TNF Receptor Type 1 His tag protein TNFR1 Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 161 amino acids fragment (41-201) having molecular weig	5	154-Eur	Biorb	recombinant
orb80623	Human TNF Receptor Type 1 protein TNFR1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 162 amino acids and having total molecular mass of 18.2 kDa. TN	5	154-Eur	Biorb	recombinant
orb80625	Human TNF Receptor Type 2 protein TNFR2 Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 184 amino acids fragment (23-206) having molecular weight of 24	5	154-Eur	Biorb	recombinant
orb80630	Human TRAIL (114-281) protein Soluble TNF-related apoptosis-inducing ligand Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 169 amino acids (114-281) an	10	154-Eur	Biorb	recombinant
CSB-EL007625MO	Mouse ELOVL family member 7, elongation of long chain fatty acids (yeast) (ELOVL7) ELISA kit, Species Mouse, Sample Type serum, plasma	96T	913-Eur	Cusabio	elisa
orb80965	Mouse BH3 Interacting Domain Death Agonist GST protein BID Mouse Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 1-195 amino acids and having a molecular mass	2	154-Eur	Biorb	recombinant
309-34111	Anti AGE_3 Monoclonal Antibody (Clone No.9D8) The products of the nonenzymatic glycation and oxidation of proteins, lipids and nucleic acids, the advanced glycation end_products (AGEs), accumulate in	10 UG	958-Eur	BBridge	monoclonal
orb80175	Human High-Mobility Group Box 1 protein HMG1 Human Recombinant fused with 6X His tag produced in E.coli is a single, non-glycosylated, polypeptide chain containing 223 amino acids and having a molecul	10	154-Eur	Biorb	recombinant
orb80473	Human IL24 protein Interleukin24 human recombinant produced in yeast is a single, glycosylated, polypeptide chain containing 158 amino acids and having a molecular mass of 18 kDa. As result of glycosi	2	154-Eur	Biorb	recombinant
orb90078	Human Dipeptidyl-Peptidase 4 protein DPPIV Human Recombinant produced in High-5 cells is a single, glycosylated polypeptide chain containing 746 amino acids (39-766) and having a molecular mass of 86.	2	154-Eur	Biorb	recombinant
orb82726	Human IL22 protein Interleukin-22 Human Recombinant produced in E.Coli is a single, non-glycosylated homodimeric polypeptide chain containing 2 x 146 amino acids and having a total MW equal to33.607 k	1 mg	2799-Eur	Biorb	recombinant
orb90092	Human Flap Structure-Specific Endonuclease 1 protein FEN1 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 380 amino acids (1-380 a.a.) and having a mole	5	154-Eur	Biorb	recombinant
orb81076	Human Estrogen Receptor Binding Site Associated Antigen 9 protein EBAG9 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 207 amino acids (28-213) and hav	10	154-Eur	Biorb	recombinant
orb80964	Mouse BH3 Interacting Domain Death Agonist protein BID Mouse Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 1-195 amino acids and having a molecular mass of	2	154-Eur	Biorb	recombinant
orb80652	Mouse C-10 protein C-10 Mouse Recombinant produced in E.coli is a single,non-glycosylated, polypeptide chain containing 95 amino acids and having a molecular mass of 10710 Dalton. The CCL6 is purified	2	154-Eur	Biorb	recombinant
orb81481	Human Crystallin Alpha B protein Recombinant CRYAB produced in E.coli is a single,non-glycosylated polypeptide chain containing 175amino acids and having a molecular mass of 20,159 Dalton. CRYAB is pu	20	154-Eur	Biorb	recombinant
orb81084	Human Eukaryotic Translation Initiation Factor 5A2 protein EIF5A2 Recombinant E.coli produced in E.coli is a single, non-glycosylated polypeptide chain containing 173 amino acids (1-153 a.a.) and havi	2	154-Eur	Biorb	recombinant
orb90106	Human Glyceraldehyde-3-Phosphate Dehydrogenase protein GAPDH Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 335 amino acids and having a molecular mass	5	154-Eur	Biorb	recombinant
orb80319	Mouse FGF 21 protein Fibroblast Growth Factor -21 Mouse Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 183 amino acids including N-terminal Methionin and ha	2	154-Eur	Biorb	recombinant
orb80032	Mouse GCSF protein Granulocyte MCSF Mouse Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 125 amino acids and having a molecular mass of 14.2 kDa.GM-CSF Mous	5	154-Eur	Biorb	recombinant
orb81243	Human Nuclear Transport Factor 2 protein NUTF2 Recombinant E.coli produced in E.coli is a single, non-glycosylated polypeptide chain containing 147 amino acids (1-127 a.a.) and having a molecular mass	5	154-Eur	Biorb	recombinant
orb80023	Bovine FGF basic protein FGF-2 Bovine Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 155 amino acids and having a molecular mass of 17250 Dalton. The Fibrob	10	154-Eur	Biorb	recombinant
orb81157	Human Hypoxia-Inducible Factor-1 Alpha protein HIF1A Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 298 amino acids (530-826) and having a molecular ma	10	154-Eur	Biorb	recombinant
orb81053	Human Cystatin-B protein CSTB Human Recombinant fused to His-Tag at N-Terminus produced in E.coli is a single, non-glycosylated polypeptide chain containing 118 amino acids and having a molecular mass	5	154-Eur	Biorb	recombinant
orb90102	E.coli Glucose-6-Phosphate Dehydrogenase protein G6PD Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 491 amino acids and having a molecular mass of 55.	10	154-Eur	Biorb	recombinant
orb80409	Porcine IL1 beta protein IL1b Porcine Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 154 amino acids and having a molecular mass of 17690 Dalton. The IL-1b is purifie	2	228-Eur	Biorb	recombinant
orb81087	Human Endosulfine Alpha protein ENSA Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 141 amino acids (1-121 a.a.) and having molecular wieght of 15.5kDa	5	154-Eur	Biorb	recombinant
orb80134	Viral MIP2 protein GRO-Beta Viral Recombinant produced in E.coli is a single,non-glycosylated, polypeptide chain containing 70 amino acids and having a molecular mass of 7.9 kDa. The CXCL2 is purified	10	154-Eur	Biorb	recombinant
orb80112	Human B-Cell Maturation Antigen protein TNFRSF17 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 50 amino acids and having a molecular mass of 5.3 kDa.	5	154-Eur	Biorb	recombinant
orb81066	Human DNA Damage Inducible Transcript 3 protein DDIT3 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 189 amino acids and having a molecular mass of 21	5	154-Eur	Biorb	recombinant
orb80691	Mouse Platelet Factor-4 protein CXCL4 Mouse Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 73 amino acids and having a molecular mass of 8.2 kDa. For researc	5	154-Eur	Biorb	recombinant
orb90019	Human Aldo-Keto Reductase Family Member A1 protein AKR1A1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 325 amino acids (1-325 a.a.) and having a mol	5	154-Eur	Biorb	recombinant
orb80426	Mouse IL5 protein IL5 Mouse Recombinant produced in E.coli is dimeric, non-glycosylated polypeptide chain containing x 113 amino acids forming disulfide linked homodimer and having a molecular mass of	2	154-Eur	Biorb	recombinant
orb90040	Human Beta-Site APP-Cleaving Enzyme 1 protein BACE-1 Human Recombinant is expressed in E.coli containing 366 amino acids 28-393.The BACE1 is purified by proprietary chromatographic techniques. For res	1	154-Eur	Biorb	recombinant
orb90037	Human Aspartate Beta-Hydroxylase protein ASPH Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 217 amino acids (75-270 a.a.) and having a molecular mass	5	154-Eur	Biorb	recombinant
orb80679	Mouse MIG protein MIG (monokine induced by gamma-interferon Mouse Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 105 amino acids and having a molecular mass	5	154-Eur	Biorb	recombinant
orb90035	Human Arginase, Liver protein ARG1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 330 amino acids (1-322a.a.) and having a molecular mass of 35.8 kDa.	5	154-Eur	Biorb	recombinant
orb81517	Saccharomyces cerevisiae Heat Shock Protein 104 protein Recombinant HSP104 produced in E.coli is a single, non-glycosylated polypeptide chain containing 908 amino acids and having a molecular mass of	10	154-Eur	Biorb	recombinant
orb81480	Human Crystallin Alpha A protein Recombinant Human CRYAA produced in E.coli is a single, non-glycosylated polypeptide chain containing 173 amino acids and having a molecular mass of 19,909 Dalton. CRY	20	154-Eur	Biorb	recombinant
orb90206	Human Poly (ADP-Ribose) Polymerase 1 protein PARP1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 354 amino acids (662-1014a.a.) and having a molecula	5	154-Eur	Biorb	recombinant
orb80818	Human Hexokinase-4 protein Glucokinase Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain fused to His tag at the N-terminal encoding the sequence of 485 amino acids	2	154-Eur	Biorb	recombinant
orb90163	Human Lecithin-Cholesterol Acyltransferase protein LCAT Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 426 amino acids (25-440) which includes 10 amin	2	154-Eur	Biorb	recombinant
orb81263	Human Progrmammed Cell Death 4 protein PDCD4 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 469 amino acids and having a molecular mass of 51 kDa. For	2	154-Eur	Biorb	recombinant
orb80819	Human Guanylate Kinase 1 protein GUK1 Human Recombinant produced in E.coli is signle, non-glycosylated, polypeptide chain containing 217 amino acids (1-197 a.a.)and having total molecular mass of 23.9	5	154-Eur	Biorb	recombinant
orb81045	Human Complexin-1 protein CPLX1 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 154 amino acids (1-134) and having total molecular mass of 17.1kDa which	10	154-Eur	Biorb	recombinant
orb81167	Human V-Ha-ras Harvey Rat Sarcoma Viral Oncogene Homolog protein HRAS Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 194 amino acids (1-186 a.a.) and	5	154-Eur	Biorb	recombinant
orb81262	Human Progrmammed Cell Death Ligand 2 protein PDCD1LG2 Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain fused to GST tag containing 274 amino acids (1-274) and hav	2	277-Eur	Biorb	recombinant
orb81147	Human Growth Factor Receptor-Bound Protein 2 protein GRB2 produced in E.coli is a single, non-glycosylated polypeptide chain containing 237 amino acids (1-207 a.a.) and having a molecular mass of 27 k	5	154-Eur	Biorb	recombinant
orb81265	Human Programmed Cell Death Interacting protein PDCD6IP Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 412 amino acids (1-392 a.a.) and having a molecu	5	154-Eur	Biorb	recombinant
orb81266	Human Podoplanin protein PDPN Human Recombinant fused to N-terminal His-Tag produced in E.coli is a single, non-glycosylated polypeptide chain containing 130 amino acids and having a molecular mass of	5	154-Eur	Biorb	recombinant
orb90204	Human Prolyl 4-Hydroxylase Beta protein P4HB Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 512 amino acids (18-508 a.a.) and having a molecular mass o	5	154-Eur	Biorb	recombinant
orb90199	Human Nudix Type Motif 5 protein NUDT5 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 239 amino acids (1-219 a.a.) and having a molecular mass of 26.5	5	154-Eur	Biorb	recombinant
orb81276	Human Pleckstrin Homology-Like Domain Family Member 2 protein PHLDA2 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 172 amino acids (1-152 a.a.) and h	2	154-Eur	Biorb	recombinant
orb80262	Mouse Apoliprotein J protein Recombinant Mouse Clusterin produced in HEK293 cells is a single, glycosylated, polypeptide chain containing 438 amino acids and having a molecular mass of 50.55kDa. The M	2	154-Eur	Biorb	recombinant
orb81287	Human Prostate Specific Membrane Antigen protein PSMA Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 150 amino acids (1-150 a.a.) fused to GST tag and	2	277-Eur	Biorb	recombinant
orb80281	Mouse beta NGF protein Recombinant Mouse b-NGF produced in E.coli is is noncovalently disulfide-linked homodimer, non-glycosylated, polypeptide chain containing identical chains of 120 amino acids eac	5	154-Eur	Biorb	recombinant
orb80500	Dog Leptin protein Leptin Dog Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 146 amino acids and having a molecular mass of 16 kDa.The Leptin is purified by	100	359-Eur	Biorb	recombinant
orb81602	Hepatitis Virus NS4 a+b protein The E.coli derived 19 kDa recombinant protein contains the HCV NS4 immunodominant regions, amino acids 1658-1863. The protein is fused with b-galactosidase (114 kDa) at	100	228-Eur	Biorb	recombinant
orb80490	Rat Leptin protein Leptin Rat Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 147 amino acids and having a molecular mass of 16 kDa.The Leptin is purified by	200	154-Eur	Biorb	recombinant
orb80174	Hirudin protein Recombinant Hirudin is derived from yeast and the polypeptide chain contains 65 amino acids and its Mw is 6979.5 dalton which is identical to natural Hirudin except for the substitutio	2	154-Eur	Biorb	recombinant
orb81661	Cytomegalo Virus gB protein The E.coli derived recombinant artificial mosaic protein contains the CMV gB immunodominant regions 11-67 amino acids, fused with 26 kDa GST Tag, the protein weight is 6.5k	100	228-Eur	Biorb	recombinant
orb84840	EGFP protein EGFP Recombinant is produced in E.coli and is a non-glycosylated, polypeptide chain containing 269 amino acids and having a molecular mass of approximately 30.6 kDa. The EGFP is purified	0.5 mg	686-Eur	Biorb	recombinant
orb81534	SARS Associated Coronavirus Nucleocaspid (1-49,192-220) protein The E.coli derived 32 kDa recombinant protein contains the Nucleocapsid core protein 1-49 amino acids immunodominant regions. For resear	100	228-Eur	Biorb	recombinant
orb81533	SARS Associated Coronavirus Nucleocaspid (1-49) protein The E.coli derived 32 kDa recombinant protein contains the Nucleocapsid core protein 1-49 amino acids immunodominant regions. For research use o	100	228-Eur	Biorb	recombinant
orb81537	SARS Associated Coronavirus Envelope protein The E.coli derived 43 kDa recombinant protein contains the N-terminus Enevelope protein 1-76 amino acids immunodominant regions. For research use only.	100	228-Eur	Biorb	recombinant
orb80348	Human Placental Corr Growth Hormone protein Placental HGH 22kDa Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 192 amino acids and having a molecular mass o	100	359-Eur	Biorb	recombinant
orb81015	Human CD95 His tag protein Recombinant FAS antigen_ CD95 purified from E.coli is a single non-glycosilated polypeptide chain containing amino acids 157-320 of Fas antigen (base pairs 713-1190 of cDNA	5	154-Eur	Biorb	recombinant
orb81518	Human Heat Shock Protein 105 protein Recombinant HSPH1 produced in E.coli is a single, non-glycosylated polypeptide chain containing 894 amino acids and having a molecular mass of 100 kDa. HSP105 ulph	5	154-Eur	Biorb	recombinant
SMC-327D	SHANK (pan) Antibody Monoclonal, Clone number: S23b-49 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 84-309 of rat Shank2; accession number Q9QX74	100ug	279-Eur	Stressmarq
26-833	ACSBG2 belongs to the ATP-dependent AMP-binding enzyme family, bubblegum subfamily.ACSBG2 mediates activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-	0.05 mg	632-Eur	Prosci
orb81159	Human Hypoxia-Inducible Factor-1 Alpha Inhibitor protein HIF1AN Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 349 amino acids and having a molecular m	10	154-Eur	Biorb	recombinant
orb80604	Human Teratocarcinoma-Derived Growth Factor 1 protein TDGF1 Human Recombinant produced in HEK-293 cells is a single, glycosylated, polypeptide chain containing 139 amino acids with molecular weight of	2	154-Eur	Biorb	recombinant
SMC-403D	GABA-B Receptor 1 Antibody Monoclonal, Clone number: S93A-49 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 873-977 (cytoplasmic C-terminus) of rat GABA(B)R1	100ug	279-Eur	Stressmarq
SMC-406D	EAAC1 Antibody Monoclonal, Clone number: S180-41 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 1-524 (full length) of human EAAC1	100ug	279-Eur	Stressmarq
orb80399	Human IGF2 protein Insulin-Like Growth Factor-II Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 67 amino acids and having a molecular mass of 7505 Dal	10	154-Eur	Biorb	recombinant
AS10 1592	Antibody: sll0528 | putative zinc metalloprotease sII0528 (100 ul), Immunogen: synthetic peptide (amino acids 271 - 286) specific for protease Sll0528, Q55518 from Synechocystis sp. PCC 6803, Host: ra	100 ul	381-Eur	Gentaur
orb80338	Human GDF5 protein Growth Differentiation Factor Human Recombinant produced in E.coli is homodimer, non-glycosylated, polypeptide chain containing x 120 amino acids and having total molecular mass of	10	154-Eur	Biorb	recombinant
orb80344	Human GCSF protein Granulocyte Colony Stimulating Factor Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 175 amino acids and having a molecular mass of	2	154-Eur	Biorb	recombinant
orb80375	Porcine GCSF protein Granulocyte MCSF Porcine Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 127 amino acids and having a molecular mass of 14381 Dalton.GM-	2	154-Eur	Biorb	recombinant
orb80785	Human Casein Kinase beta protein CSNK2B Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 215 amino acids and having total molecular mass of 24 kDa. CK2	2	154-Eur	Biorb	recombinant
SMC-388D	IP3 Receptor Monoclonals AntibodiesS24-18 Fusion protein amino acids 2680-2749 (cytoplasmic carboxyl terminus) of rat type1 IP3R inositol 1,4,5-triphosphate receptor type 1, Itpr1	100ug	324-Eur	Stressmarq
orb80099	Human soluble CD40 Ligand_TRAP protein sCD40 Human Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 149 amino acids and having a molecular mass of 16308 Dalton. The sCD	10	154-Eur	Biorb	recombinant
30-937	ACSBG2 belongs to the ATP-dependent AMP-binding enzyme family, bubblegum subfamily.ACSBG2 mediates activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-	0.05 mg	632-Eur	Prosci
orb81400	Human Small Ubiquitin-Related Modifier 2 protein SUMO2 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 93 amino acids and having a molecular mass of 10.	10	154-Eur	Biorb	recombinant
SMC-375D	Contactin Antibody Monoclonal, Clone number: S73-20 Host: Mouse, Isotype: IgG1 Immunogen: Synthetic peptide amino acids 21-37 (D_EFTWHRRYGHGVSEEDKC) extracellular domain of rat contactin, accession nu	100ug	279-Eur	Stressmarq
orb90268	E.coli KBP-Type Peptidyl-Prolyl Cis-Trans Isomerase protein SlyD Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 196 amino acids and having a molecular mass o	5	154-Eur	Biorb	elisa
orb80366	Porcine Growth Hormone protein Porcine-Somatotropin Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 190 amino acids and having a molecular mass of 21730 Dalt	100	154-Eur	Biorb	recombinant
SMC-379D	Zinedin Antibody Monoclonal, Clone number: S88-64 Host: Mouse, Isotype: IgG2a Immunogen: Fusion protein amino acids 42-354 of human Zinedin_Striatin-4, accession number Q9NRL3	100ug	279-Eur	Stressmarq
SMC-373D	Nav1.2 Antibody Monoclonal, Clone number: S69-3 Host: Mouse, Isotype: IgG2a Immunogen: Fusion protein amino acids 1882-2005 (cytoplasmic C-terminus) of rat Nav1.2	100ug	279-Eur	Stressmarq
orb80368	Ovine Growth Hormone Anatagonist protein Somatotropin Ovine Antagonist Recombinant G119R produced in E.coli is a single, non-glycosylated polypeptide chain containing 191 amino acids and having a mole	100	359-Eur	Biorb	recombinant
orb80578	Mouse soluble CD40 Ligand_TRAP protein sCD40 Mouse Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 149 amino acids and having a molecular mass of 16409 Dalton. The sCD	5	154-Eur	Biorb	recombinant
orb80371	Human GCSF Pichia protein Granulocyte MCSF Human Recombinant produced in Yeast is a single, glycosylated, polypeptide chain containing 127 amino acids and having a molecular mass of 26-32 kDa. rhGMCSF	2	154-Eur	Biorb	recombinant
AS10 1623	Antibody: sll0528 | putative zinc metalloprotease sII0528 (300 ul), Immunogen: synthetic peptide (amino acids 271 - 286) specific for protease Sll0528, Q55518 from Synechocystis sp. PCC 6803, Host: ra	300 ul	871-Eur	Gentaur
MA1114	Monoclonal Anti-γ-Tubulin, Clone number: IMD-20, Ig type: mouse IgG1, Immunogen: Synthetic γ-tubulin peptide (amino acids 38-53), conjugated to KLH., Specificity: Human,rat. No cross reactivity with o	100μg/vial	232-Eur	Bouster Immunoleader
orb80647	Human Vascular Endothelial Growth Inhibitor protein TNFSF15 Human Recombinant produced in E.coli is a double, non-glycosylated, polypeptide chain containing 192 amino acids and having a molecular mass	2	154-Eur	Biorb	recombinant
AS10 1589	Antibody: PPIase CYP37 | peptidyl-prolyl cis-trans isomerase CYP37, chloroplastic (100 ul) , Immunogen: synthetic peptide (amino acids 277 – 290) specific for chloroplast cyclophilin from Ar	100 ul	381-Eur	Gentaur
orb90252	Human Proteasome Subunit Alpha Type 7 protein PSMA7 Human Recombinant fused to N-terminal His-Tag produced in E.coli is a single, non-glycosylated polypeptide chain containing 268 amino acids (1-248)	10	154-Eur	Biorb	recombinant
orb81650	Hepatitis Surface Antigen adr subtype, Saccharomyces protein Recombinant HBsAg adr full length monomeric protein contains 227 amino acids of the S-gene molecular weight of 24 kDa. Small amounts of dim	10	154-Eur	Biorb	recombinant
orb81516	Human Heat Shock Protein 90kDa Beta (GRP94) Member 1 protein HSP90B1 produced in E.coli is a single, non-glycosylated polypeptide chain containing 819 amino acids (22-803 a.a.) and having a molecular	2	154-Eur	Biorb	recombinant
SMC-323D	Slo2.2 Antibody Monoclonal, Clone number: S3-26 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 1168-1237 of rat Slo2.2 (Slack); NP_068625	100ug	279-Eur	Stressmarq
orb81430	Human Triggering Receptor Expressed on Myeloid Cells 1 protein TREM1 Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 180 amino acids fragment (21-200)	2	154-Eur	Biorb	recombinant
SMC-330D	BK Beta3a Antibody Monoclonal, Clone number: S40B-18 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 1-49 (unique N-terminus) of mouse BKBeta3a	100ug	279-Eur	Stressmarq
orb80010	Human BNP protein BNP Peptide Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. NPPB is purifi	2	154-Eur	Biorb	recombinant
orb80111	Human TNF-alpha, Mutant protein TNF-a Variant Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 151 amino acids and having a molecular mass of 16598 Dalt	10	154-Eur	Biorb	recombinant
orb81415	Human Transforming Growth Factor Beta Induced protein TGFBI Human Recombinant (fourth FAS domain) produced in E.coli is a single, non-glycosylated, polypeptide containing 135 amino acids (502-636) and	5	154-Eur	Biorb	recombinant
orb80824	Human Integrin Linked Kinase protein ILK1 Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 452 amino acids fragment (1-452) having a molecular mass of 5	2	154-Eur	Biorb	recombinant
orb80251	Human Adiponectin Globular protein gAcrp30 Human Recombinant produced in E.coli is homodimeric, non-glycosylated, Polypeptide chain containing 145 amino acids and having a molecular mass of 16690 Dalt	5	154-Eur	Biorb	recombinant
orb80347	Mouse GCSF protein Granulocyte Colony Stimulating Factor Mouse Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 179 amino acids and having a molecular mass of	2	154-Eur	Biorb	recombinant
orb80629	Human TRAIL protein Soluble TNF-related apoptosis-inducing ligand Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 168 amino acids and having a molecular	10	154-Eur	Biorb	recombinant
orb80543	Human PDGF BB, Yeast protein Platelet-Derived Growth Factor BB Human Recombinant is homodimeric, glycosylated, polypeptide chain containing 109 amino acids and having a molecular mass of 32,021 Dalton	2	154-Eur	Biorb	recombinant
orb80346	Human GCSF CHO protein Granulocyte Colony Stimulating Factor Human Recombinant produced in E.coli is a single, glycosylated, polypeptide chain containing 174 amino acids and having a molecular mass of	2	154-Eur	Biorb	recombinant
orb80367	Chicken Growth Hormone Anatagonist protein Somatotropin Chicken Antagonist Recombinant mutein G119R produced in E.coli is a single, non-glycosylated polypeptide chain containing 191 amino acids with a	100	359-Eur	Biorb	recombinant
orb81307	Human Retinoic Acid Receptor Responder 2 protein RARRES2 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 138 amino acids and having total molecular mas	5	154-Eur	Biorb	recombinant
orb81331	Human Retinoid Receptor Alpha protein RXRA Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 119 amino acids having a molecular mass of 13.6 kDa. For rese	10	154-Eur	Biorb	recombinant
orb80999	Human Core Binding Factor Beta protein CBFB Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 182 amino acids (1-202 a.a.) and having a molecular mass of	2	154-Eur	Biorb	recombinant
orb90219	Human Peptidyl-Prolyl Cis_Trans Isomerase protein PPIase Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 163 amino acids having a molecular mass of 18.2	5	154-Eur	Biorb	recombinant
orb81162	Human High-Mobility Group Nucleosome Binding Domain 1 protein HMGN1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 108 amino acids (1-100 a.a.) and ha	2	154-Eur	Biorb	recombinant
orb81080	Human Eukaryotic Translation Initiation Factor Subunit Alpha protein EIF2S1 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 335 amino acids (1-315 a.a.)	2	154-Eur	Biorb	recombinant
SMC-419D	mGluR1_5 (Group 1) Glutamate Receptor Antibody Monoclonal, Clone number: S75-3 Host: Mouse, Isotype: IgG2A Immunogen: Fusion protein amino acids 824-1203 (cytoplasmic C-terminus) of rat mGluR5b, acces	100ug	279-Eur	Stressmarq
orb80314	Mouse FGF 9 protein FGF 9 Mouse Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 205 amino acids and having a molecular mass of 23308 Dalton.The FGF-9 Mouse R	2	154-Eur	Biorb	recombinant
orb90287	E.coli Thioredoxin Reductase protein TRXR E.coli Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 321 amino acids (1-321 a.a.) and having a molecular mass of	5	154-Eur	Biorb	recombinant
orb80872	Human TIE-1 Fc Chimera protein Soluble TIE-1 Human Recombinant fused with the Fc part of human IgG1 produced in baculovirus is homodimeric, glycosylated, polypeptide containing 749 amino acids and hav	2	154-Eur	Biorb	recombinant
orb80333	Human Galectin 4 protein Galectin 4 produced in E.coli is a single, non-glycosylated polypeptide chain containing 343 amino acids (1-323 a.a.) and having a molecular mass of 38.1kDa.Galectin 4 is fuse	5	154-Eur	Biorb	recombinant
orb80712	Exenatide protein Exenatide is a single, non-glycosylated, peptide containing 39 amino acids and having a molecular mass of 4186.6 Dalton. Exenatide has the empirical formula C184H282N50O60S. For rese	1 mg	293-Eur	Biorb
EGE-248	Nucleic acids: pLEXSY_I-egfp-neo3 integrative inducible control vector with egfp geneantibiotic selection of transfectants with LEXSY Neo and expression monitoring with EGFP fluorescence	5	467-Eur	Jena Bio
orb81532	SARS Associated Coronavirus Nucleocaspid (340-390) protein The E.coli derived 32kDa recombinant protein contains the Nucleocapsid core protein 340-390 amino acids immunodominant regions. For research	100	228-Eur	Biorb	recombinant
EGE-236	Nucleic acids: pLEXSY-cherry-sat2 integrative constitutive control vector with cherry geneantibiotic selection of transfectants with LEXSY NTC and expression monitoring with Cherry fluorescence	5	467-Eur	Jena Bio
orb81620	Hepatitis Virus NS5 protein The E.coli derived recombinant protein contains the HCV NS5 immunodominant regions, amino acids 2061-2302. The protein is fused with GST at N-terminus. For research use onl	100	228-Eur	Biorb	recombinant
EGE-235	Nucleic acids: pLEXSY-egfp-sat2 integrative constitutive control vector with egfp geneantibiotic selection of transfectants with LEXSY NTC and expression monitoring with EGFP fluorescence	5	467-Eur	Jena Bio
orb81193	Lamin-A protein Recombinant Lamin produced in E.coli is a single, non-glycosylated polypeptide chain containing 645 amino acids and having a molecular mass of 70 kDa. Lamin-A is major component of the	2	154-Eur	Biorb	recombinant
orb80694	Rat Rantes protein Rantes Rat Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 68 amino acids and having a molecular mass of 7876 Dalton. The Rat Rantes is pur	5	154-Eur	Biorb	recombinant
orb82790	Mouse CXCL12 protein Recombinant mouse CXCL12 is a non-glycosylated polypeptide chain containing 72 amino acids. For research use only.	1 mg	2079-Eur	Biorb	recombinant
bs-2501P	Peptides: KiSS-1R_GPR54_GPCR54(KiSS-1 receptor_G-Protein Coupled Receptor 54) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0422P	Peptides: A_H1N1-M2 Swine(Avian influenza Matrix Protein-2 Swine) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2135P	Peptides: FABP(brain) (Fatty acid-binding protein brain) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2194P	Proteins: EGFP protein_rEGFP_Recombinant EGFP(Enhanced Green Fluorecent protein) Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
CLK-AA007-10	Amino acids or its derivatives: 5-Azido-L-ornithine HCl, 10 mg pack 5-Azido-L-norvaline HCl(S)-2-Amino-5-azidopentanoic acid hydrochloride	10mg	146-Eur	Jena Bio
CLK-AA007-100	Amino acids or its derivatives: 5-Azido-L-ornithine HCl, 100 mg pack 5-Azido-L-norvaline HCl(S)-2-Amino-5-azidopentanoic acid hydrochloride	100mg	392-Eur	Jena Bio
CLK-AA007-5	Amino acids or its derivatives: 5-Azido-L-ornithine HCl, 5 mg pack 5-Azido-L-norvaline HCl(S)-2-Amino-5-azidopentanoic acid hydrochloride	5mg	106-Eur	Jena Bio
CLK-AA008-500	Amino acids or its derivatives: 5-Azido-D-ornithine HCl, 500 mg pack 5-Azido-D-norvaline HCl(R)-2-Amino-5-azidopentanoic acid hydrochloride	500mg	899-Eur	Jena Bio
CLK-AA008-5	Amino acids or its derivatives: 5-Azido-D-ornithine HCl, 5 mg pack 5-Azido-D-norvaline HCl(R)-2-Amino-5-azidopentanoic acid hydrochloride	5mg	106-Eur	Jena Bio
bs-2017P	Peptides: 14-3-3 family protein(Malus domestica (Apple) (Malus sylvestris)) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
SMC-403D	GABA(B)R1 Protein, S93A-49 Monoclonals AntibodiesS93A-49 Fusion protein amino acids 873-977 (cytoplasmic C-terminus) of rat GABA(B)R1	100ug	324-Eur	Stressmarq
CLK-AA008-100	Amino acids or its derivatives: 5-Azido-D-ornithine HCl, 100 mg pack 5-Azido-D-norvaline HCl(R)-2-Amino-5-azidopentanoic acid hydrochloride	100mg	392-Eur	Jena Bio
CLK-AA008-10	Amino acids or its derivatives: 5-Azido-D-ornithine HCl, 10 mg pack 5-Azido-D-norvaline HCl(R)-2-Amino-5-azidopentanoic acid hydrochloride	10mg	146-Eur	Jena Bio
bs-1430P	Peptides: A_H1N1-M2 Human(Avian influenza Matrix Protein-2 Human) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
CLK-AA007-500	Amino acids or its derivatives: 5-Azido-L-ornithine HCl, 500 mg pack 5-Azido-L-norvaline HCl(S)-2-Amino-5-azidopentanoic acid hydrochloride	500mg	899-Eur	Jena Bio
SMC-394D	VGlut1 Neurotransmitter Transporter Protein, S28-9 Monoclonals AntibodiesS28_9 Fusion protein amino acids 493-560 (cytoplasmic C-temrinus) of rat VGlut1	100ug	324-Eur	Stressmarq
orb82711	Human IGFBP3 protein Recombinant Human IGFBP3 is a single, non-glycosylated polypeptide chain containing 264 amino acids. For research use only.	1 mg	2079-Eur	Biorb	recombinant
SMC-395D	VGlut2 Neurotransmitter Transporter Protein, S29-29 Monoclonals AntibodiesS29_29 Fusion protein amino acids 501-582 (cytoplasmic C-terminus) of rat VGlut2.	100ug	324-Eur	Stressmarq
SMC-396D	MMP9 Matrix Metalloproteinase Protein, S51-82 Monoclonals AntibodiesS51_82 Fusion protein amino acids 1-708 (full length) of rat MMP9	100ug	324-Eur	Stressmarq
orb82716	Human IL11 protein Recombinant Human IL11 is a single, non-glycosylated polypeptide chain containing 178 amino acids. For research use only.	1 mg	2799-Eur	Biorb	recombinant
orb82828	SDF1 beta protein Recombinant Rat SDF1 beta is a single, non-glycosylated polypeptide chain containing 72 amino acids. For research use only.	1 mg	2079-Eur	Biorb	recombinant
orb81524	Soy Bean P34 Protein His tag protein The E.coli derived His Tag recombinant protein 36kDa, contains Soybean P34 Protein epitopes 214-261, 351-379 amino acids. For research use only.	100	228-Eur	Biorb	recombinant
SMC-406D	EAAC1 Protein, S180-41 Monoclonals AntibodiesS180_41 Fusion protein amino acids 1-524 (full length) of human EAAC1	100ug	324-Eur	Stressmarq
SMC-397D	VGlut3 Neurotransmitter Transporter Protein, S34-34 Monoclonals AntibodiesS34_34 Fusion protein amino acids 546-588 (cytoplasmic C-terminus) of rat VGlut3.	100ug	324-Eur	Stressmarq
orb82669	Human CCL14 protein Recombinant human CCL14 is a single, non-glycosylated polypeptide chain containing 72 amino acids. For research use only.	1 mg	2079-Eur	Biorb	recombinant
orb82680	Human CXCL3 protein Recombinant human CXCL3 is a single, non-glycosylated polypeptide chain containing 73 amino acids. For research use only.	1 mg	2079-Eur	Biorb	recombinant
orb82730	Human IL33 protein Recombinant human IL33 is a single, non-glycosylated polypeptide chain containing 159 amino acids. For research use only.	1 mg	2799-Eur	Biorb	recombinant
orb60872	DL-Carnitine hydrochloride DL-Carnitine hydrochloride is a quaternary ammonium compound biosynthesized from the amino acids lysine and methionine. For research use only.	10 mg	203-Eur	Biorb	rna
bs-1158PC	Proteins: AGEs control article(advanced glycosylation end products control article) Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
orb82661	Human BAFF protein Recombinant Human BAFF is a single, non-glycosylated polypeptide chain containing 153 amino acids. For research use only.	1 mg	3127-Eur	Biorb	recombinant
orb82673	Human CX3CL1 protein Recombinant human CX3CL1 is a single, non-glycosylated polypeptide chain containing 76 amino acids. For research use only.	1 mg	2079-Eur	Biorb	recombinant
31011	BRD1 (561-668), GST-tag, Human Recombinant Protein,Human Bromodomain containing 1, also known as BRD1 and BRL, amino-acids 561 – 668 (GenBank Accession No. NM_014577) with N-terminal GST tag, MW = 40	100	429-Eur	BPS Bioscience
orb82676	Human CXCL11 protein Recombinant Human CXCL11 is a single, non-glycosylated polypeptide chain containing 73 amino acids. For research use only.	1 mg	2079-Eur	Biorb	recombinant
orb82674	Human CXCL1 protein Recombinant Human CXCL1 is a single, non-glycosylated, polypeptide chain containing 73 amino acids. For research use only.	1 mg	2079-Eur	Biorb	recombinant
orb80732	Hexarelin protein Hexarelin stimulates GH secretion. Hexarelin is more resistant to proteolytic degradation than GHRP-6. Hexarelin has amino acids H-His-D-2-Methyl-Trp-Ala-Trp-D-Phe-Lys-NH2 and having	20 mg	408-Eur	Biorb	hrp
orb82710	Human IFN gamma protein Recombinant Human IFN gamma is a single, non-glycosylated, polypeptide chain containing 144 amino acids. For research use only.	1 mg	997-Eur	Biorb	recombinant
SMC-348D	Kv2.1, S4-11 Monoclonals AntibodiesS4-11 Bacterially expressed GST Bacterially expressed GSTfusion protein corresponding to amino acids 509-853 of rat KV2.1, accession number NM_004975.	100ug	324-Eur	Stressmarq
orb82672	Human CNTF protein Recombinant Human CNTF is a single, non-glycosylated polypeptide chain containing 199 amino acids. For research use only.	1 mg	2079-Eur	Biorb	recombinant
orb80724	Human Glucagon Like Peptide-2 protein Glucagon Like Peptide-2 contains 34 amino acids having a molecular mass of 3922.38 Dalton. For research use only.	1 mg	154-Eur	Biorb	human
orb82696	Human Exodus 2 protein Recombinant human Exodus 2 is a single, non-glycosylated polypeptide chain containing 111 amino acids. For research use only.	1 mg	2079-Eur	Biorb	recombinant
bs-0189P	Peptides: Actin Alpha _Alpha-SMA (Actin alpha , smooth muscle aorta) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0174P	Peptides: ER-Alpha_ Beta Estrpgen Receptor Alpha_ Beta Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2475P	Peptides: CCL4_MIP-1 Beta(Macrophage Inflammatory Protein 1 beta) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
orb82809	Mouse MCP2 protein Recombinant mouse Monocyte Chemotactic Protein 2 contains 74 amino acids. For research use only.	1 mg	2079-Eur	Biorb	recombinant
bs-0625P	Peptides: ZNF268 (zinc finger protein ZNF268)- N-terminal (1a) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-2063P	Peptides: p- Beta catenin(p-beta Catenin(phosphor-Y142)) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0626P	Peptides: ZNF268 (zinc finger protein ZNF268)- middle (1b) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0627P	Peptides: ZNF268 (zinc finger protein ZNF268)- middle (1c) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0628P	Peptides: ZNF300 (zinc finger protein ZNF300)- middle Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
SMC-392D	KCC2 Transporter Protein, S1-12 Monoclonals AntibodiesS1_12 Fusion protein amino acids 932-1043 corresponding to rat KCC2	100ug	324-Eur	Stressmarq
45-195	ACOX2 Antibody. Please note this antibody was designed using the mouse sequence, which differs by 1 amino acids from the human sequence.	0.1 mg	482-Eur	Prosci	human
bs-1433P	Peptides: MEK1_MAPKK1(mitogen activated protein kinase kinase 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-1806P	Peptides: UTS2R_GPR14(Urotensin II receptor：G Protein Coupled Receptor 14) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
orb80292	Human CTGF 182-250 a.a. protein The CTGF amino acids 182-250, produced in E.coli, is fusion protein with His Tag (4 kDa), having total molecular mass of 15 kDa. For research use only.	4	154-Eur	Biorb	recombinant
orb81769	Measles Virus Nucleocapsid protein The E.coli derived recombinant protein contains the nucleocapsid immunodominant regions, 89-165 amino acids. For research use only.	100	228-Eur	Biorb	recombinant
orb81523	Soy Bean P34 protein The E.coli derived recombinant protein contains Soybean P34 Protein epitopes 214-261, 351-379 amino acids. The protein is fused to GST tag at N-terminus. For research use only.	100	228-Eur	Biorb	recombinant
orb81633	Hepatitis B Virus Core (1-183) protein The E.coli derived 18 kDa recombinant protein contains the HBV core ayw immunodominant region, amino acids 1-183. For research use only.	100	228-Eur	Biorb	recombinant
orb82757	Human NRG1 protein Recombinant Human NRG1 EGF-like domain is a single non-glycosylated polypeptide chain containing 61 amino acids. For research use only.	1 mg	1831-Eur	Biorb	recombinant
18-461-10407	G-protein coupled bile acid receptor 1 - Membrane-type receptor for bile acids; M-BAR; hGPCR19; BG37; hBG37 Polyclonal	0.05 ml	502-Eur	GenWay	recombinant
orb82741	Human MCP4 protein Recombinant human Monocyte Chemotactic Protein 4 is a non-glycosylated polypeptide chain containing 75 amino acids. For research use only.	1 mg	2079-Eur	Biorb	recombinant
orb81671	Toxoplasma Gondii MIC3 protein The E.coli derived recombinant protein contains the MIC3 immunodominant regions, amino acids 234-306. For research use only.	100	228-Eur	Biorb	recombinant
orb82740	Human MCP2 protein Recombinant human Monocyte Chemotactic Protein 2 is a non-glycosylated polypeptide chain containing 76 amino acids. For research use only.	1 mg	2079-Eur	Biorb	recombinant
18-461-10285	G-protein coupled bile acid receptor 1 - Membrane-type receptor for bile acids; M-BAR; hGPCR19; BG37; hBG37 Polyclonal	0.05 ml	502-Eur	GenWay	recombinant
18-461-10152	G-protein coupled bile acid receptor 1 - Membrane-type receptor for bile acids; M-BAR; hGPCR19; BG37; hBG37 Polyclonal	0.05 ml	578-Eur	GenWay	recombinant
bs-2073P	Peptides: phospho-GSK3 Alpha_ Beta(alpha + beta)(phospho Tyr279 + Tyr216) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
18-461-10408	G-protein coupled bile acid receptor 1 - Membrane-type receptor for bile acids; M-BAR; hGPCR19; BG37; hBG37 Polyclonal	0.05 ml	502-Eur	GenWay	recombinant
SMC-409D	SUR1 Protein, S289-16 Monoclonals AntibodiesS289-16 Fusion protein amino acids 1548-1582 (cytoplasmic C-terminus) of rat SUR1	100ug	324-Eur	Stressmarq
orb80486	Human Leptin protein Leptin Human produced syntheticaly contains 35 amino acids (22-56 a.a.) having a molecular mass of 3950.6 Dalton. For research use only.	200	154-Eur	Biorb	human
orb80948	Batroxobin protein The Batroxobin Recombinant Protein, produced in yeast, is a single, glycosilated polypeptide chain containing 213 amino acids and having 28-33 kDa. For research use only.	10	154-Eur	Biorb	recombinant
orb82702	Human FLT3 Ligand protein Recombinant Human FLT3LG_Flt3 Ligand is non-glycosylated, polypeptide chain containing 155 amino acids. For research use only.	1 mg	2144-Eur	Biorb	recombinant
45-306	ATGL Antibody. Pease note this antibody was designed using the Mouse sequence NP_080078.1, which differs by 2 amino acids from the Human sequence NP_065109.1.	0.1 mg	482-Eur	Prosci	human
SMC-362D	KvBeta1.2 Antibody Monoclonal, Clone number: S47-42 Host: Mouse, Isotype: IgG1 Immunogen: Synthetic peptide amino acids 9-28 (ADIPSPKLGLPKSSESALKC, unique N-terminus) of rat KvBeta1.2, accession numbe	100ug	279-Eur	Stressmarq
SMC-381D	WAVE1_SCAR Antibody Monoclonal, Clone number: S91-36 Host: Mouse, Isotype: IgG1 Immunogen: Synthetic peptide amino acids 477-498 of human Wave1_Wasp family1, accession number Q92558	100ug	279-Eur	Stressmarq
SMC-389D	CNGA1_3 Antibody Monoclonal, Clone number: S36-12 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 535-637 (cytoplasmic Cterminus) of goldfish CNG, accession number AAO16601.	100ug	279-Eur	Stressmarq
SMC-422D	TARPGamma2_4_8Antibody Monoclonal, Clone number: S245-36 Host: Mouse, Isotype: IgG2A Immunogen: Fusion protein amino acids 203-323 (Cytoplasmic C-terminus) of rat TARPGamma2, accession number Q71RJ3	100ug	279-Eur	Stressmarq
SMC-421D	TARPGamma2_Stargazin Antibody Monoclonal, Clone number: S245-1 Host: Mouse, Isotype: IgG2A Immunogen: Fusion protein amino acids 203-323 (Cytoplasmic C-terminus) of rat TARPGamma2, accession number Q7	100ug	279-Eur	Stressmarq
SMC-338D	SAPAP (pan) Antibody Monoclonal, Clone number: S127-31 Host: Mouse, Isotype: IgG2b Immunogen: Fusion protein amino acids 772-992 (C-terminus) of rat SAPAP1, accession number P97836.	100ug	279-Eur	Stressmarq
25-892	SLC27A6 is a member of the fatty acid transport protein family (FATP). FATPs are involved in the uptake of long-chain fatty acids and have unique expression patterns. Alternatively spliced transcript	0.05 mg	632-Eur	Prosci	rna
AS10 1595	Antibody: PPIase CYP37 | peptidyl-prolyl cis-trans isomerase CYP37, chloroplastic (300 ul) , Immunogen: synthetic peptide (amino acids 277 – 290) specific for chloroplast cyclophilin At3g155	300 ul	871-Eur	Gentaur
SMC-409D	SUR1 Antibody Monoclonal, Clone number: S289-16 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 1548-1582 (cytoplasmic C-terminus) of rat SUR1	100ug	279-Eur	Stressmarq
SMC-301D	CaV1.3 Antibody Monoclonal, Clone number: S48A-9 Host: Mouse, Isotype: IgG2a Kappa Immunogen: Fusion protein amino acids 859-875 of rat Cav1.3, accession numbr P27732	100ug	279-Eur	Stressmarq
orb81598	Mosaic Hepatitis Virus NS4 Genotype-3 protein The E.coli derived recombinant protein contains the HCV NS4 immunodominant regions, amino acids 1691-1710, 1712-1733 1921-1940, fused with GST tag at N-te	100	228-Eur	Biorb	recombinant
AS10 704	Antibody: PsbA | D1 protein of PSII, DE-loop, Immunogen: KLH-conjugated synthetic peptide, amino acids 234-242 of D1 protein P83755, Host: rabbit, polyclonal, Confirmed reactivity: dicots: A.thaliana,	50	342-Eur	Gentaur
orb81596	Mosaic Hepatitis Virus NS4 Genotype-1 protein The E.coli derived recombinant protein contains the HCV NS4 immunodominant regions, amino acids 1691-1710, 1712-1733 1921-1940, fused with GST tag at N-te	100	228-Eur	Biorb	recombinant
CSB-EL007623MO	Mouse ELOVL family member 5, elongation of long chain fatty acids (FEN1_Elo2, SUR4_Elo3-like, yeast) (ELOVL5) ELISA kit, Species Mouse, Sample Type serum, plasma	96T	913-Eur	Cusabio	elisa
CSB-EL007624HU	Human ELOVL family member 6, elongation of long chain fatty acids (FEN1_Elo2, SUR4_Elo3-like, yeast) (ELOVL6) ELISA kit, Species Human, Sample Type serum, plasma	96T	913-Eur	Cusabio	elisa
CSB-EL007623HU	Human ELOVL family member 5, elongation of long chain fatty acids (FEN1_Elo2, SUR4_Elo3-like, yeast) (ELOVL5) ELISA kit, Species Human, Sample Type serum, plasma	96T	913-Eur	Cusabio	elisa
orb81111	Human Factor VIII protein Antihemophilic Facor Human Recombinant produced in CHO is glycosylated polypeptide chain having total amino acids of 1438 (170kd) and consisting of two dimer chains 80 kD and	250 IU	1325-Eur	Biorb	recombinant
CSB-EL007624CH	Chicken ELOVL family member 6, elongation of long chain fatty acids (FEN1_Elo2, SUR4_Elo3-like, yeast) (ELOVL6) ELISA kit, Species Chicken, Sample Type serum, plasma	96T	913-Eur	Cusabio	elisa
CSB-EL007623BO	Bovine ELOVL family member 5, elongation of long chain fatty acids (FEN1_Elo2, SUR4_Elo3-like, yeast) (ELOVL5) ELISA kit, Species Bovine, Sample Type serum, plasma	96T	913-Eur	Cusabio	elisa
orb80045	Human IGF1 protein Insulin-Like Growth Factor-I Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 70 amino acids and having a molecular mass of 7655 Dalt	20	154-Eur	Biorb	recombinant
orb80397	Mouse IGF1 protein Insulin-Like Growth Factor mouse Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 70 amino acids and having a molecular mass of 7600 Dalton	10	154-Eur	Biorb	recombinant
orb80585	Mouse Soluble RANK Ligand protein sRANKL Mouse Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 174 amino acids and having total molecular mass of 19.9kDa.CD2	2	154-Eur	Biorb	recombinant
orb80336	Human GDNF protein Glial derived Neurotrophic Factor Human Recombinant produced in E.coli is homodimer, non-glycosylated, polypeptide chain containing x 135 amino acids and having total molecular mass	2	154-Eur	Biorb	recombinant
CSB-EL007624MO	Mouse ELOVL family member 6, elongation of long chain fatty acids (FEN1_Elo2, SUR4_Elo3-like, yeast) (ELOVL6) ELISA kit, Species Mouse, Sample Type serum, plasma	96T	913-Eur	Cusabio	elisa
orb80538	Human PDGF AA protein Platelet-Derived Growth Factor AA Human Recombinant is homodimeric, non-glycosylated, polypeptide chain containing x 125 amino acids and having total molecular mass of 28511 Dalt	2	154-Eur	Biorb	recombinant
orb80871	Human Transforming Growth Factor Beta Receptor II protein TGFBR2 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain encoding 133 amino acids (27-159 a.a.), the extra	2	154-Eur	Biorb	recombinant
orb80830	Human Lymphatic Vessel Endothelial Hyaluronic Acid Receptor (25-235) protein LYVE1 Human Recombinant produced in insect cells is a single, glycosylated polypeptide chain containing 229 amino acids and	2	154-Eur	Biorb	recombinant
orb80583	Human Soluble RANK Ligand protein sRANKL Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 176 amino acids and having a molecular mass of 20006 Dalton. CD	2	154-Eur	Biorb	recombinant
orb80131	Human MIP2 protein GRO-Beta Human Recombinant produced in E.coli is a single,non-glycosylated, polypeptide chain containing 73 amino acids and having a molecular mass of 7908 Dalton. The CXCL2 is puri	2	154-Eur	Biorb	recombinant
orb81599	Mosaic Hepatitis Virus NS4 Genotype-5 protein The E.coli derived recombinant protein contains the HCV NS4 immunodominant regions, amino acids 1691-1710, 1712-1733 1921-1940, fused with GST tag at N-te	100	228-Eur	Biorb	recombinant
orb81258	Human Proliferating Cell Antigen protein PCNA Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 261 amino acids and having a molecular mass of 28769 Dalto	5	154-Eur	Biorb	recombinant
orb80101	Rhesus Macaque Serum Amyloid (APO-SAA1) protein SAA1 monkey Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 104 amino acids and having total molecular mass o	2	154-Eur	Biorb	recombinant
orb81597	Mosaic Hepatitis Virus NS4 Genotype-2 protein The E.coli derived recombinant protein contains the HCV NS4 immunodominant regions, amino acids 1691-1710, 1712-1733 1921-1940, fused with GST tag at N-te	100	228-Eur	Biorb	recombinant
orb80288	Rat CNTF protein CNTF Recombinant Rat produced in E.coli is a single, non-glycosylated polypeptide chain containing 200 amino acids and having a molecular mass of 22834 Dalton. The CNTF is purified by	5	154-Eur	Biorb	recombinant
orb80055	Human IL2 protein IL2 Human Recombinant produced in E.coli is a single, non-glycosylated mutein (variant form) of human IL-2 polypeptide chain containing 134 amino acids and having a molecular mass of	10	154-Eur	Biorb	recombinant
orb80641	Rat VEGF protein VEGF Rat Recombinant produced in E.coli is a double, non-glycosylated, polypeptide chain containing 164 amino acids and having a molecular mass of 38417 Dalton.The VEGF is purified by	2	154-Eur	Biorb	recombinant
orb80874	Human TIE-2 Fc Chimera protein Soluble TIE-2 Human Recombinant fused with the Fc part of human IgG1 produced in baculovirus is monomeric, glycosylated, polypeptide containing 730 amino acids and havin	2	154-Eur	Biorb	recombinant
EGE-247	Nucleic acids: pLEXSY_I-egfp-ble3 integrative inducible control vector with egfp geneantibiotic selection of transfectants with LEXSY Bleo and expression monitoring with EGFP fluorescence	5	467-Eur	Jena Bio
bs-1046P	Peptides: MIP-1 Beta (macrophage inflammatory protein 1 Beta) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0488P	Peptides: CXorf36(uncharacterized protein Cxorf36 precursor) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
SMC-401D	SNAT1 Protein, S104-32 Monoclonals AntibodiesS104-32 Fusion protein amino acids 1- 63 of rat SNAT1	100ug	324-Eur	Stressmarq
bs-0641P	Peptides: Integrin Alpha 4_ITGA4(Integrin alpha 4) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0696P	Peptides: HSP-90Alpha(Heat Shock Protein 90Alpha ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
orb82820	Protein G (190-384) Recombinant Protein G contains 196 amino acid residues which are amino acids 190-384 of the Streptococcus sp. For research use only.	1 g	1915-Eur	Biorb	elisa
TS 022	VITAMINS AMINO GROWTH SUPPLEMENT (VITAMINS & AMINO ACIDS MIXTURE) (DOUBLE PACK) (Store below 8º C)	5 vl	99-Eur	TitanBiotech
bs-1641P	Peptides: phospho GAP-43(pSer41)(phospho Growth associated protein 43 ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
IVL04-100ML	Cell Culture Media,Bovine IVF Media,KSOM+AA ,KSOM with amino acids.	100ml	66-Eur	Caisson Laboratory
bs-0889P	Peptides: HSP-90 Alpha(Heat Shock Protein 90 Alpha ) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0135P	Peptides: HSP-90 Beta (heat sock protein-90 Beta) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
TS 022	VITAMINS AMINO GROWTH SUPPLEMENT (VITAMINS & AMINO ACIDS MIXTURE) (DOUBLE PACK) (Store below 8º C)	5 vl	99-Eur	TitanBiotech
bs-0337P	Peptides: myelin P0 prothein( peripheral myelin prothein Zero;MPZ;MPP) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-820-485XL	Nucleic acids: EDA-GTP - DY-485XL	40	746-Eur	Jena Bio
NU-820-480XL	Nucleic acids: EDA-GTP - DY-480XL	40	746-Eur	Jena Bio
NU-808-485XL	Nucleic acids: EDA-ATP - DY-485XL	40	746-Eur	Jena Bio
NU-808-480XL	Nucleic acids: EDA-ATP - DY-480XL	40	746-Eur	Jena Bio
NU-802-480XL	Nucleic acids: EDA-ADP - DY-480XL	40	746-Eur	Jena Bio
NU-802-485XL	Nucleic acids: EDA-ADP - DY-485XL	40	746-Eur	Jena Bio
orb81770	Measles Virus Hemagglutinin Mosaic (1-30,115-150,379-410) protein The E.coli derived recombinant protein contains the large hemagglutinin immunodominant regions 1-30, 115-150 and 379-410 amino acids.	100	228-Eur	Biorb	recombinant
orb81669	Varicella Zoster Virus ORF9 protein The E.coli derived recombinant protein contains the VZV ORF9 immunodominant regions, amino acids 6-28, 76-100. For research use only.	100	228-Eur	Biorb	recombinant
26-813	ST6GALNAC2 belongs to a family of sialyltransferases that add sialic acids to the nonreducing ends of glycoconjugates. At the cell surface, these modifications have roles in cell-cell and cell-substra	0.05 mg	632-Eur	Prosci	cat
orb81670	Varicella Zoster Virus ORF26 protein The E.coli derived recombinant protein contains the VZV ORF26 immunodominant regions, amino acids 9-33, 184-208. For research use only.	100	228-Eur	Biorb	recombinant
orb81632	Hepatitis B Virus Core (1-186) protein The E.coli derived recombinant protein contains the HBV core immunodominant region amino acids 1-186, and fused to His tag. For research use only.	100	228-Eur	Biorb	recombinant
orb80696	Human SDF 1 beta His Tag protein SDF-1 beta Human Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 93 amino acids (22-93 a.a.) and having a molecular mass of 10.8 KDa.	2	154-Eur	Biorb	recombinant
orb81308	Human Retinoblastoma Associated protein Retinoblastoma Human Recombinant fused with 6X His tag produced in E.coli is a single, non-glycosylated, polypeptide chain containing 146 amino acids and having	10	154-Eur	Biorb	recombinant
orb80616	Human TGF Beta (644-850) protein TGFB3 Human Recombinant protein encoding amino acids 644-850 and total molecular mass of 50 kDa (Including GST Tag). For research use only.	2	277-Eur	Biorb	recombinant
SPC-173C	RAS Antibody Polyclonal Host: Rabbit Immunogen: Synthetic peptide corresponding to amino acids 31-43 of human RAS. (The immunogen peptide is from the effector binding loop (l2) of the H, K and N-Ras (	25ug	119-Eur	Stressmarq
SPC-173D	RAS Antibody Polyclonal Host: Rabbit Immunogen: Synthetic peptide corresponding to amino acids 31-43 of human RAS. (The immunogen peptide is from the effector binding loop (l2) of the H, K and N-Ras (	100ug	243-Eur	Stressmarq
orb80428	Human IL6 protein Human IL6 Recombinant produced in CHO is a single, glycosylated polypeptide chain containing 185 amino acids and migrates at 22 kDa as glycosilated protein on SDS-PAGE.The IL6 is pur	2	154-Eur	Biorb	recombinant
orb80678	Human MEC His Tag protein CCL28 Human Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 126 amino acids (23-127 a.a.) and having a molecular mass of 14.3 kDa. The CCL28	5	154-Eur	Biorb	recombinant
orb80096	Human Oncostatin-M (209 a.a.) protein Oncostatin-M (209 a.a.) Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 209 amino acids and having a molecular mas	2	154-Eur	Biorb	recombinant
EIAAB12847	3-keto acyl-CoA synthase ELOVL6,Chicken,Elongation of very long chain fatty acids protein 6,ELOVL6,Gallus gallus,RCJMB04_16d24		1333-Eur	EIAab
31024	BRD2, BD1 and BD2 (65-459), GST-tag, Human Recombinant Protein,Human Bromodomain containing 2, also known as BRD2, RING3 or RNF3, amino-acids 65 – 459 (GenBank Accession No. NM_005104) with N-termina	100	429-Eur	BPS Bioscience
orb81445	E.coli Thioredoxin, His protein Recombinant Thioredoxin produced in E.coli is a single, non-glycosylated polypeptide chain containing 119 amino acids (2-109 a.a.) and having a molecular mass of 12.9kD	2	154-Eur	Biorb	recombinant
SMC-345D	GABA-A-receptor-delta, S151-3 Monoclonals AntibodiesS151-3 Synthetic peptide amino acids 15-34 of rat GABA-A-R-Delta, accession number P18506	100ug	324-Eur	Stressmarq
orb82670	Human CCL7 protein Recombinant Human Monocyte Chemotactic Protein 3 is a single, non-glycosylated polypeptide chain containing 76 amino acids. For research use only.	1 mg	2079-Eur	Biorb	recombinant
orb82704	Human GMCSF protein Recombinant human GMCSF is a single, non-glycosylated polypeptide chain containing 127 amino acids and has a MWequal to14.5 kDa. For research use only.	1 mg	2079-Eur	Biorb	recombinant
orb60024	Terlipressin Terlipressin(Glypressin) is similar to a naturally occurring hormone present in the body, known as antidiuretic hormone (ADH) or vasopressin and contains 12 amino acids. For research use	100 mg	342-Eur	Biorb
30-911	ST6GALNAC2 belongs to a family of sialyltransferases that add sialic acids to the nonreducing ends of glycoconjugates. At the cell surface, these modifications have roles in cell-cell and cell-substra	0.05 mg	632-Eur	Prosci	cat
SMC-388D	IP3 Receptor Antibody Monoclonal, Clone number: S24-18 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 2680-2749 (cytoplasmic carboxyl terminus) of rat type1 IP3R inositol 1,4,5-triph	100ug	279-Eur	Stressmarq
orb80725	Glucagon protein Glucagon Human Synthetic peptide is a single, non-glycosylated, polypeptide chain containing 29 amino acids and having a molecular mass of 3485 Dalton.The Glucagon is purified by prop	4 mg	490-Eur	Biorb	human
AS10 1621	Antibody: slr1821 | putative zinc metalloprotease slr1821 (300 ul), Immunogen: synthetic peptide (amino acids 216 – 230) specific for protease Slr1821 from Synechocystis sp. PCC 6803, P73714	300 ul	871-Eur	Gentaur
orb80132	Mouse MIP2 protein GRO-Beta Mouse Recombinant also caled mouse MIP-2 produced in E.coli is a single,non-glycosylated, polypeptide chain containing 73 amino acids and having a molecular mass of 7849 Da	2	154-Eur	Biorb	recombinant
EGE-246	Nucleic acids: pLEXSY_I-egfp-blecherry3 integrative inducible control vector with egfp geneantibiotic selection of transfectants with LEXSY Bleo and expression monitoring with EGFP and Cherry fluoresc	5	467-Eur	Jena Bio
AS10 1596	Antibody: slr1821 | putative zinc metalloprotease slr1821 (100 ul), Immunogen: synthetic peptide (amino acids 216 – 230) specific for protease Slr1821 from Synechocystis sp. PCC 6803, P73714	100 ul	381-Eur	Gentaur
orb81482	Mouse Crystallin Alpha B protein Recombinant CRYAB Mouse produced in E.coli is a single, non-glycosylated polypeptide chain containing 175 amino acids and having a molecular mass of 20 kDa. Mouse CRYA	5	154-Eur	Biorb	recombinant
29-922	SLC7A8 is sodium-independent, high-affinity transport of large neutral amino acids. It has higher affinity for L-phenylalanine than LAT1 but lower affinity for glutamine and serine. L-alanine is trans	0.1 mg	496-Eur	Prosci
orb90065	Human Cyclophilin G protein Cyclophilin G Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 195amino acids (1-175 a.a.) and having a molecular mass of 21	5	154-Eur	Biorb	recombinant
orb80446	Mouse IL15 His tag protein IL15 Mouse Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 152 amino acids (49-162 a.a.) and having a molecular mass of 17.6 kDa. T	2	154-Eur	Biorb	recombinant
orb81391	Human Stathmin-1 protein Recombinant Human Stathmin-1 produced in E.coli is a single, non-glycosylated polypeptide chain containing 169 amino acids (1-149 a.a) and having a molecular mass of 19.4 kDa.	5	154-Eur	Biorb	recombinant
orb90075	Human Deoxyribonuclease I protein Deoxyribonuclease Human Recombinant produced in CHO is glycosylated, polypeptide chain containing 260 amino acids and having total molecular mass of 37,000 Dalton wit	500 IU	154-Eur	Biorb	recombinant
orb82703	Human GCSF protein Recombinant Human GCSF, produced in E. coli, is a single, non-glycosylated, polypeptide chain containing 174 amino acids and having a MW equal to 18.671 kDa. For research use only.	1 mg	2799-Eur	Biorb	recombinant
orb81392	Human Stathmin Like-2 protein Recombinant Human Stathmin Like-2 produced in E.coli is a single, non-glycosylated polypeptide chain containing 142 amino acids (39-179 a.a) and having a molecular mass o	2	154-Eur	Biorb	recombinant
orb81617	Hepatitis Virus NS5 Genotype-5 protein The E.coli derived recombinant protein contains the HCV NS5 Genotype immunodominant regions, amino acids 2212-2313. For research use only.	100	228-Eur	Biorb	recombinant
orb81398	Human Syntaxin-1A protein Syntaxin-1A Human Recombinant fused to N-terminal His-Tag produced in E.coli is a single, non-glycosylated polypeptide chain containing 226 amino acids (1-226) and having a m	5	154-Eur	Biorb	recombinant
orb80899	Human Actin-Like 6A protein Actin-Like 6A Human Recombinant produced in E.coli is non-glycosylated, polypeptide chain containing 430 (1-429) amino acids and having total molecular mass of 49.3 kda. AC	2	154-Eur	Biorb	recombinant
SMC-324D	Slo2.1_ SLICK potassium channel, S11-33 Monoclonals AntibodiesS11-33 Fusion protein amino acids 564-624 of mouse Slo2.1 (Slick), accession number XP_920840	100ug	324-Eur	Stressmarq
orb81126	Human Frataxin protein Frataxin Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 190 amino acids (42-210 a.a.) and having a molecular mass of 21.1 kDa.	5	154-Eur	Biorb	recombinant
orb81199	Listeriolysin-O protein Molecular weight of Listeriolysin is 58kDa. This haemolysin protein is provided in its mature form that is constituted by 503 amino acids, from 26 to 529 of the registered sequ	10	244-Eur	Biorb
orb81402	Human Surfeit-1 protein Surfeit-1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 215 amino acids (80-273 a.a.) and having a molecular mass of 24.3 kDa	5	154-Eur	Biorb	recombinant
orb80312	Human FGF 4 protein FGF4 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 177 amino acids (31-206) and having a molecular mass of 19.3 kDa.The FGF4 is p	5	154-Eur	Biorb	recombinant
orb80993	Human Calumenin protein Recombinant Human Calumenin produced in E.coli is a single, non-glycosylated polypeptide chain containing 317 amino acids (20-315 a.a) and having a molecular mass of 37.2 kDa.	5	154-Eur	Biorb	recombinant
orb90270	Human Sepiapterin Reductase protein Sepiapterin Reductase produced in E.coli is a single,non-glycosylated polypeptide chain containing 281 amino acids (1-261 a.a.) and having a molecular mass of 30.2	5	154-Eur	Biorb	recombinant
orb80436	Mouse IL9 protein IL9 Mouse Recombinant produced in E.coli is a single, non-glycosylated single polypeptide chain containing 127amino acids and having a molecular mass of 14,166 Dalton. The IL-9 is pu	2	154-Eur	Biorb	recombinant
orb80723	Human Glucagon Like Peptide-1 (7-36) protein Glucagon Like Peptide-1 is a single, non-glycosylated, polypeptide chain containing 30 amino acids and having a molecular mass of 3298.7 Dalton. The GLP-1	1 mg	154-Eur	Biorb	human
orb81447	Human Thioredoxin His Tag protein Thioredoxin Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 125 amino acids (1-105 a.a.) and having a molecular mass	5	154-Eur	Biorb	recombinant
orb80264	Canine Apoliprotein J protein Apoliprotein canine Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 433 amino acids and having a molecular mass of 50.6 kDa. Th	2	154-Eur	Biorb	recombinant
orb90058	Human Quinone Oxidoreductase-like Protein 1 protein CRYZL1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 369 amino acids (1-349 a.a.) and having a mo	5	154-Eur	Biorb	recombinant
orb81512	Human Heat Shock Protein 27 His tag protein Recombinant Human HSP-27 produced in E.coli is a single, non-glycosylated polypeptide chain containing 225 amino acids (1-205 a.a.) and having a molecular m	5	154-Eur	Biorb	recombinant
orb90119	Human Glutaredoxin 2 protein Glutaredoxin-2 Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 154 amino acids (20-164 a.a.) and having a molecular mass o	5	154-Eur	Biorb	recombinant
orb80408	Mouse IL1 beta His tag protein IL1 beta Mouse Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 189 amino acids and having a molecular mass of 21 kDa. The IL-1b is fused	5	154-Eur	Biorb	recombinant
orb90064	Human Cyclophilin E protein Cyclophilin E Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 337 amino acids (1-301 a.a.) and having a molecular mass of 3	5	154-Eur	Biorb	recombinant
orb90062	Human Cyclophilin B protein Cyclophilin B Human Recombinant produced in E.coli is a single, non-glycosylated,polypeptide chain containing 192 amino acids (26-216) and having a molecular mass of 21.2 k	20	154-Eur	Biorb	recombinant
orb90149	Human HIV-1 Tat Interactive Protein 2 protein HTATIP2 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 262 amino acids (1-242 a.a.) and having a molecula	5	154-Eur	Biorb	recombinant
orb81743	HTLV-1 gp21 protein The E.coli derived recombinant protein contains the gp21 immunodominant region, 351-404 amino acids, the MW is 21kDa. Fused with GST tag at N-Terminus. For research use only.	100	228-Eur	Biorb	recombinant
orb80284	Human BNP Protein His Tag protein BNP Peptide Recombinant Human produced in E.coli is a single, non-glycosylated, polypeptide chain containing 129 amino acids and having a molecular mass of 14 kDa. NP	2	154-Eur	Biorb	recombinant
orb80676	Human MCP4 His tag protein MCP4 Human Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 96 amino acids (24-98) and having a molecular mass of 10.8 kDa. The MCP-4 is fuse	1	154-Eur	Biorb	elisa
orb80751	Human Procalcitonin His Tag protein Procalcitonin Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 114 amino acids fragment (3-116) having a molecular m	2	154-Eur	Biorb	recombinant
orb82759	Human Oncostatin M protein Recombinant human Oncostatin M is a single, non-glycosylated polypeptide chain containing 227 amino acids. less than _pGreater thanOncostatin M (OSM) is a growth and differe	1 mg	2799-Eur	Biorb	recombinant
orb80654	Human Eotaxin His tag protein Eotaxin His Tag Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 74 amino acids fragment (24-87) corresponding to the matur	5	154-Eur	Biorb	recombinant
orb80497	Salamander Leptin protein Leptin Salamander Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a mol	100	359-Eur	Biorb	recombinant
orb90208	Human Protein-L-Isoaspartate O-Methyltransferase protein PCMT1 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 263 amino acids (1-227 a.a.) and having a	5	154-Eur	Biorb	recombinant
orb81210	Human Microtubule-Associated Protein Tau protein MAPT Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 372 amino acids (1-352 a.a.) and having a molecula	2	154-Eur	Biorb	recombinant
orb80435	Human IL9 protein Human IL9 Recombinant produced in E.coli is a single, non-glycosylated single polypeptide chain containing 127amino acids and having a molecular mass of 14,004 Dalton. The IL-9 is pu	2	154-Eur	Biorb	recombinant
orb82666	Human BMP4 inactive protein Recombinant Human Bone Morphogenetic protein-4 is a monomeric, non-glycosylated, polypeptide chain containing 116 amino acids. For research use only.	1 mg	1831-Eur	Biorb	recombinant
orb80750	Human Procalcitonin protein Procalcitonin Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 116 amino acids and having a molecular mass of 12.7 kDa.The P	2	154-Eur	Biorb	recombinant
orb90242	Human Peroxiredoxin 1 protein Peroxiredoxin Human Recombinant fused with His tag at N-terminus produced in E.coli is a single, non-glycosylated, polypeptide chain containing 219 amino acids and having	5	154-Eur	Biorb	recombinant
orb80962	Human Bcl2 His Tag protein Bcl-XL Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing amino acids 1-210. The Bcl-XL is expressed as His-Tag fusion protein a	2	154-Eur	Biorb	recombinant
orb80828	Human Ketohexokinase protein Ketohexokinase Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 298 amino acids and having a molecular mass of 32.7 kDa. For	5	154-Eur	Biorb	recombinant
orb80307	Mouse FGF acidic protein FGF acidic Mouse Recombinant (FGF-1) produced in E.coli is a single, non-glycosylated, polypeptide chain containing 141 amino acids and having a molecular mass of 15.9 kDa.The	10	154-Eur	Biorb	recombinant
orb81404	Human Syndecan-4 His tag protein Syndecan-4 Human Recombinant fused with 6X His tag produced in E.coli is a single, non-glycosylated, polypeptide chain containing 140 amino acids and having a molecula	10	154-Eur	Biorb	recombinant
orb80967	Human Survivin protein Survivin Human Recombinant fused to 152 a.a. N-terminal CaM-Tag produced in E.coli is a single, non-glycosylated polypeptide chain containing 294 amino acids (1-142 a.a.) and ha	5	154-Eur	Biorb	recombinant
orb80277	Human BMP7 His Tag protein BMP7 Human Recombinant produced in E.coli is monomeric, non-glycosylated, polypeptide chain containing 148 amino acids (293-431) and having a molecular mass of 16.8 kDa. The	10	154-Eur	Biorb	recombinant
orb90291	Human Thymidylate Synthetase protein Thymidylate synthase Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 333 amino acids (1-313 a.a.) and having a mol	5	154-Eur	Biorb	recombinant
orb80559	Human Prolactin His tag protein Prolactin-His Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 199 amino acids fragment (29-227) and having a molecular m	5	154-Eur	Biorb	recombinant
orb81700	HIV-1 gp41 protein HIV-1 env gp41 Strain IIIB is non-glycosylated 288 amino acids polypeptide chain (a.a. 466-753) having a molecular mass of 32kDa. The protein is fused to B-galactosidase (114 kDa) a	100	228-Eur	Biorb
orb80407	Human IL1 beta His tag protein Human IL1 beta His-tag Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 153 amino acids fragment (117-269) and having total mol	5	154-Eur	Biorb	recombinant
NU-811-647N	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - ATTO-647N	40	746-Eur	Jena Bio
NU-835-Desthiobio	Nucleic acids: N6-(6-Amino)hexyl-dATP - Desthiobiotin, pack Desthiobiotin-7-dATP	50	172-Eur	Jena Bio
NU-1619-BIOX	Nucleic acids: Biotin-11-ddUTP, pack Biotin-X-5-Propargylamino-ddUTP	25	237-Eur	Jena Bio
NU-811-540Q	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - ATTO-540Q	40	746-Eur	Jena Bio
NU-1611-FAMX	Nucleic acids: Fluorescein-12-dATP Fluorescein-X-7-Deaza-7-propargylamino-dATP	25	209-Eur	Jena Bio
NU-811-RHO13	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - ATTO-Rho13	40	746-Eur	Jena Bio
NU-811-RHO14	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - ATTO-Rho14	40	746-Eur	Jena Bio
bs-0466P	Peptides: Beta-casein( Beta-casein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-811-RHO6G	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - ATTO-Rho6G	40	746-Eur	Jena Bio
NU-811-THIO12	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - ATTO-Thio12	40	746-Eur	Jena Bio
NU-812-612Q	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - ATTO-612Q	40	746-Eur	Jena Bio
bs-0857P	Peptides: Beta-arrestin 1_2(beta-arrestin 1_2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-812-540Q	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - ATTO-540Q	40	746-Eur	Jena Bio
NU-812-580Q	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - ATTO-580Q	40	746-Eur	Jena Bio
NU-812-RHO13	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - ATTO-Rho13	40	746-Eur	Jena Bio
NU-811-580Q	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - ATTO-580Q	40	746-Eur	Jena Bio
NU-812-RHO12	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - ATTO-Rho12	40	746-Eur	Jena Bio
NU-812-RHO11	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - ATTO-Rho11	40	746-Eur	Jena Bio
NU-812-RHO101	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - ATTO-Rho101	40	746-Eur	Jena Bio
NU-812-647N	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - ATTO-647N	40	746-Eur	Jena Bio
NU-811-RHO12	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - ATTO-Rho12	40	746-Eur	Jena Bio
NU-812-THIO12	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - ATTO-Thio12	40	746-Eur	Jena Bio
NU-812-RHO14	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - ATTO-Rho14	40	746-Eur	Jena Bio
NU-812-RHO6G	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - ATTO-Rho6G	40	746-Eur	Jena Bio
NU-811-612Q	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - ATTO-612Q	40	746-Eur	Jena Bio
NU-811-RHO101	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - ATTO-Rho101	40	746-Eur	Jena Bio
orb80576	Human CD4 (203-317) protein CD-4 Human Recombinant His Tag protein encoding 203-317 amino acids. For research use only.	5	154-Eur	Biorb	recombinant
Y-0044	Peptides: Amyloid Beta 25-35( Beta-Amyloid 25-35) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-811-RHO11	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - ATTO-Rho11	40	746-Eur	Jena Bio
AS10 1588	Antibody: HtrA | putative serine protease (300 ul), Immunogen: synthetic peptide (amino acids 159 – 172) specific for Synechocystis sp. PCC 6803 HtrA Slr1204, Host: rabbit, polyclonal, Conf	300 ul	871-Eur	Gentaur
SMC-440D	GluA1_GluR1 Glutamate Receptor Antibody Monoclonal, Clone number: S355-1 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 1-389 (extracellular N-terminus) of rat GluA1_GluR1, accession	100ug	279-Eur	Stressmarq
SMC-429D	GluN2A_NR2A Glutamate Receptor Antibody Monoclonal, Clone number: S327-95 Host: Mouse, Isotype: IgG2A Immunogen: Fusion protein amino acids 75-325 (extracellular N-terminus) of rat GluN2A_NR2A, access	100ug	279-Eur	Stressmarq
AS08 283	Antibody: HSP101 | ClpB heat shock protein, N-terminal, Immunogen: recombinant Arabidopsis thaliana Hsp101_ClpB, N-terminal 145 amino acids P42730, Host: hen, polyclonal, Confirmed reactivity: Arabido	200	337-Eur	Gentaur
AS10 1602	Antibody: HtrA | putative serine protease (100 ul), Immunogen: synthetic peptide (amino acids 159 – 172) specific for Synechocystis sp. PCC 6803 HtrA Slr1204, Host: rabbit, polyclonal, Conf	100 ul	381-Eur	Gentaur
orb81238	Human Nuclear Receptor Subfamily Group H, Member 2 protein LXRB Human Recombinant produced in plants is a single polypeptide chain containing 293 amino acids and having total molecular mass of 31.9kDa	2	277-Eur	Biorb	recombinant
SMC-344D	TrpC5 Antibody Monoclonal, Clone number: S67-15 Host: Mouse, Isotype: IgG2b Immunogen: Synthetic peptide amino acids 827-845 of human TrpC5 (also known as short transient receptor potential channel 5,	100ug	279-Eur	Stressmarq
SMC-200D	DNMT1 Antibody Monoclonal, Clone number: 60B1220.1 Host: Mouse, Isotype: IgG1 Kappa Immunogen: Raised against a synthetic peptide corresponding to amino acids 637-650 of human DNMT1 (Gene accession nu	100ug	279-Eur	Stressmarq
orb80448	Porcine IL15 protein IL15 Porcine Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 114 amino acids and having a molecular mass of 13,118 Dalton. The IL-15 is p	2	154-Eur	Biorb	recombinant
orb81093	Human Endoplasmic Reticulum Protein 44 protein ERP44 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 415 amino acids (30-406 a.a.) and having a molecula	5	154-Eur	Biorb	recombinant
orb80749	Pramlintide protein Pramlintide Synthetic is a single, non-glycosylated polypeptide chain containing 37 amino acids, having a molecular mass of 3949.4 Dalton and a molecular formula of C171H267N51O53S	1 mg	154-Eur	Biorb
orb80363	Mai Mai Growth Hormone protein Growth Hormone Mai Mai Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 190 amino acids and having a molecular mass of 21810 Da	100	359-Eur	Biorb	recombinant
orb80737	Human Leuprolide protein Leuprolide Human Synthetic is a single, non-glycosylated, polypeptide chain containing amino acids and having a molecular mass of 1209 Dalton. For research use only.	5 mg	170-Eur	Biorb	human
orb80082	Human IL31 protein Human IL31 recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 141 amino acids (24-164 a.a.) and having a molecular mass of 15.8 kDa. For rese	2	154-Eur	Biorb	recombinant
orb90267	Human S-Phase Kinase-Associated Protein 2 protein SKP2 Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 205 amino acids (221-425 a.a.) fused to GST tag	2	277-Eur	Biorb	recombinant
26-066	BAAT is a liver enzyme that catalyzes the transfer of C24 bile acids from the acyl-CoA thioester to either glycine or taurine, the second step in the formation of bile acid-amino acid conjugates. The	0.05 mg	632-Eur	Prosci	cat
orb90085	Human Neuronal Specific Enolase protein ENO2 Human Recombinant expressed in E.coli contains 434 amino acids and its Mw is 47 kDa. The Enolase-2 is purified by proprietary chromatographic techniques. F	5	154-Eur	Biorb	recombinant
orb81472	Human Visinin-Like Protein-1 protein VSNL1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 191 amino acids (1-191 a.a.) and having a molecular mass of	10	154-Eur	Biorb	recombinant
26-103	Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. EPRS is a multifunctional aminoacyl-tRNA synthetase that catalyzes the aminoacylation of glutamic ac	0.05 mg	632-Eur	Prosci	rna
orb80757	Somatostatin protein Somatostatin Synthetic is a single, non-glycosylated polypeptide chain containing 14 amino acids, having a molecular mass of 1637.9 Dalton and a molecular formula of C76H104N18O19	1 mg	154-Eur	Biorb
orb90236	Human Peptidylprolyl Isomerase (Cyclophilin)-Like 1 protein PPIL1 Human Recombinant protein produced in E.coli is a single, non-glycosylated, polypeptide chain containing 174 amino acids (1-166) and h	10	154-Eur	Biorb	recombinant
orb80640	Mouse VEGF His Tag protein VEGF Mouse Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 141 amino acids (205-324 a.a.) and having total molecular mass of 16.3k	2	154-Eur	Biorb	recombinant
orb81372	Human Synaptosomal-associated protein 25B protein SNAP25B Human Recombinant fused to N-terminal His-Tag produced in E.coli is a single, non-glycosylated polypeptide chain containing 206 amino acids an	5	154-Eur	Biorb	recombinant
orb90243	Human Peroxiredoxin 2 protein PRDX2 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 198 amino acids and having a molecular mass of 21.8 kDa.The PRDX2 i	5	154-Eur	Biorb	recombinant
orb81371	Synaptosomal-associated protein 25kDa, C.elegans protein Recombinant C.elegans SNAP-25 produced in E.coli is a single, non-glycosylated polypeptide chain containing 207 amino acids and having a molecu	10	154-Eur	Biorb	recombinant
orb90239	Human Protein Phosphatase 1G protein PPM1G Human Recombinant fused with His-tag at N-terminus produced in E.coli is a single, non-glycosylated, polypeptide chain containing 250 amino acids and having	10	154-Eur	Biorb	recombinant
orb84835	NUDT1 protein NUDT1 Human Recombinant fused with a 20 amino acid His tag at N-terminus produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 176 amino acids (1-156 a.a.) and h	5	154-Eur	Biorb	recombinant
orb80391	Human Interferon-gamma His Tag protein Interferon-g Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 143 amino acids fragment (24-166) and having a mole	10	154-Eur	Biorb	recombinant
orb80649	Human Visfatin His tag protein Visfatin Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 511 amino acids and having a molecular mass of 57 kDa. The reco	5	154-Eur	Biorb	recombinant
orb81497	E.coli GroES (HSP10) protein Recombinant GroES produced in E.coli is a single, non-glycosylated polypeptide chain containing 97 amino acids and having a molecular mass of 10.4 kDa. For research use on	20	154-Eur	Biorb	recombinant
orb80671	Human Lymphotactin (XCL1) His Tag protein XCL1 Human Recombinant produced in E.coli is a single,non-glycosylated, polypeptide chain containing 114 amino acids (22-114 a.a.) and having a molecular mass	2	154-Eur	Biorb	recombinant
CSB-PA007622GA01HU	Rabbit anti-human elongation of very long chain fatty acids (FEN1_Elo2, SUR4_Elo3, yeast)-like 4 polyclonal Antibody Primary antibody Host:Rabbit IgG	150ul	749-Eur	Cusabio
CSB-PA007620GA01HU	Rabbit anti-human elongation of very long chain fatty acids (FEN1_Elo2, SUR4_Elo3, yeast)-like 2 polyclonal Antibody Primary antibody Host:Rabbit IgG	50ul	425-Eur	Cusabio
CSB-PA007622GA01HU	Rabbit anti-human elongation of very long chain fatty acids (FEN1_Elo2, SUR4_Elo3, yeast)-like 4 polyclonal Antibody Primary antibody Host:Rabbit IgG	50ul	425-Eur	Cusabio
orb80153	Human MIP3 alpha protein MIP-3 Alpha Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 70 amino acids and having a molecular mass of kDa. The MIP-3a is p	5	154-Eur	Biorb	recombinant
orb81726	HIV-1 TAT, Biotin Labeled protein HIV-1 TAT Biotin Recombinant- produced in E.coli is a single, non-glycosylated, polypeptide chain containing 86 amino acids encoded by two exons and having chain havi	1	154-Eur	Biorb	recombinant
orb81486	E.coli Dnak (HSP70) protein Recombinant Dnak produced in E.coli is a single, non-glycosylated polypeptide chain containing 638 amino acids and having a molecular mass of 69 kDa. For research use only.	10	154-Eur	Biorb	recombinant
orb80075	Mouse IL13 protein IL13 Mouse Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 110 amino acids and having a molecular mass of 12 kDa. The IL-13 is purified by	2	154-Eur	Biorb	recombinant
orb80148	Mouse MEC protein CCL28 Mouse Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 111 amino acids and having a molecular mass of 12.6 kDa. The CCL28 is purified	5	154-Eur	Biorb	recombinant
orb81032	Human Calcium Binding Protein P22 protein CHP Recombinant E.coli produced in E.coli is a single, non-glycosylated polypeptide chain containing 216 amino acids (1-195 a.a.) and having a molecular mass	5	154-Eur	Biorb	recombinant
SMC-405D	Anti-CAV3.1 CA2+ Channel Protein, S178A-9 Monoclonals AntibodiesS178A-9 Fusion protein amino acids 2052-2172 (cytoplasmic C-temrinus) of mouse Cav3.1	100ug	324-Eur	Stressmarq
orb81230	Human NCK Adaptor Protein 1 protein NCK1 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 397 amino acids (1-377 a.a.) and having a molecular mass of 45	5	154-Eur	Biorb	recombinant
orb80474	Mouse IL27 protein IL27 Mouse Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 207 amino acids and having a molecular mass of 23.7 kDa. The Murine IL-27 is pur	2	154-Eur	Biorb	recombinant
orb80477	Mouse IL31 protein IL31 mouse recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 141 amino acids and having a molecular mass of 15.7 kDa. For research use only.	2	154-Eur	Biorb	recombinant
orb81055	Human Catenin, Beta Interacting Protein 1 protein CTNNBIP1 Recombinant E.coli produced in E.coli is a single, non-glycosylated polypeptide chain containing 101 amino acids (1-81 a.a.) and having a mol	5	154-Eur	Biorb	recombinant
orb80995	Human Capping Protein Gelsolin-Like protein CAPG Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 348 amino acids (1-348 a.a.) and having a molecular mas	5	154-Eur	Biorb	recombinant
CSB-PA007620GA01HU	Rabbit anti-human elongation of very long chain fatty acids (FEN1_Elo2, SUR4_Elo3, yeast)-like 2 polyclonal Antibody Primary antibody Host:Rabbit IgG	150ul	749-Eur	Cusabio
orb81705	HIV-1 gp41 Long (513-674 a.a.) protein The E.coli derived protein contains the full-length sequence of N-terminal epitopes of HIV-I gp41 288 amino acids (466-753) immunodominant regions gp41L. The pro	100	228-Eur	Biorb	recombinant
orb90277	Human Transaldolase protein TALDO1 Human Recombinant protein produced in E.coli is a single, non-glycosylated, polypeptide chain containing 357 amino acids (1-337) and having a molecular mass of 39.7	5	154-Eur	Biorb	recombinant
orb81406	Human SUB1 Homolog protein SUB1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 147 amino acids (1-127 a.a.) and having a molecular mass of 16.5 kDa. T	2	154-Eur	Biorb	recombinant
orb81058	Human Cystatin C protein Cystatin-C Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 129 amino acids and having a molecular mass of 14.5 kDa. The protei	5	154-Eur	Biorb	recombinant
orb80518	Human MCSF His tag protein MCSF Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 179 amino acids (33-190 a.a.) and having total molecular mass of 20.7 k	5	154-Eur	Biorb	recombinant
orb80147	Human MEC protein CCL28 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 108 amino acids and having a molecular mass of 12.3 kDa. The CCL28 is purified	5	154-Eur	Biorb	recombinant
PA2073	Polyclonal Anti-ALDH2, Ig type: Rabbit IgG, Immunogen: A synthetic peptide corresponding to a sequence at the N-terminal of human ALDH2, different from the related mouse sequence by two amino acids, a	100ug/vial	232-Eur	Bouster Immunoleader
orb80491	Pegylated Rat Leptin protein Mono-Pegylated Leptin Rat Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 147 amino acids and an additional Ala at N-terminus ha	5	154-Eur	Biorb	recombinant
orb80711	Elcatonin protein Elcatonin Synthetic is a single, non-glycosylated polypeptide chain containing 31 amino acids, having a molecular mass of 3363.2 Dalton and a molecular formula of C148H244N42O47. For	1 mg	244-Eur	Biorb	cat
orb80493	Ovine Leptin, MTS tag protein Leptin Ovine MTS tagged Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 157 amino acids and having a molecular mass of 17.5 kDa	100	359-Eur	Biorb	recombinant
orb90309	Urate Oxidase protein Urate Oxidase Recombinant produced in E.coli is tetrameric, non-glycosylated polypeptide chain containing 302 amino acids, having molecular formula of C1523H2383N417O462S7 and mo	100	154-Eur	Biorb	recombinant
orb81491	Myobacterium Tuberculosis DnaK (HSP70) protein Recombinant Mycobacterium Tuberculosis Dnak produced in E.coli is a single, non-glycosylated polypeptide chain containing 625 amino acids and having a mo	2	154-Eur	Biorb	recombinant
orb80650	Mouse Visfatin protein Visfatin Mouse Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing His tag and having 511 amino acids.The total molecular mass is 57 kDa.	5	154-Eur	Biorb	recombinant
orb80097	Human Otoraplin protein Otoraplin Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 111 amino acids and having a molecular mass of 12.7 kDa.The OTOR is p	5	154-Eur	Biorb	recombinant
SMC-348D	Kv2.1 Antibody Monoclonal, Clone number: S4-11 Host: Mouse, Isotype: IgG1 Immunogen: Bacterially expressed GST Bacterially expressed GSTfusion protein corresponding to amino acids 509-853 of rat KV2.1	100ug	279-Eur	Stressmarq
orb80095	Human Oncostatin-M protein Oncostatin-M Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 227 amino acids and having a molecular mass of 26kDa. The OSM is	2	154-Eur	Biorb	recombinant
orb80702	Argipressin protein Argipressin Synthetic is a single, non-glycosylated polypeptide chain containing amino acids, having a molecular mass of 1084.2 Dalton and a molecular formula of C46H65N16O12S2. Fo	5 mg	154-Eur	Biorb
orb81104	Human FABP6 protein FABP6 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 128 amino acids and having a molecular mass of 14 kDa. For research use only.	5	154-Eur	Biorb	recombinant
orb80661	Human GRO-gamma His tag protein GRO-Gamma Human Recombinant produced in E.coli is a single,non-glycosylated, polypeptide chain containing 94 amino acids (35-107) and having a molecular mass of 7902 Da	2	154-Eur	Biorb	recombinant
orb80596	Human Retinol Binding Protein-4 protein RBP-4 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 184 amino acids and having a molecular mass of 21 kDa.The	5	154-Eur	Biorb	recombinant
orb80597	Human Retinol Binding Protein-4 His Tag protein RBP-4 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 204 amino acids and having a molecular mass of 23	2	154-Eur	Biorb	recombinant
orb90109	Human Glyoxalase-I protein Glyoxalase-I Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 184 amino acids and having a molecular mass of 20.7 kDa. Glyoxa	10	154-Eur	Biorb	recombinant
orb90142	Human Heme Oxygenase 1 protein HO-1 Human Recombinant protein produced in E.coli is a single, non-glycosylated, polypeptide chain containing 274 amino acids (1-266) and having a molecular mass of 31.4	10	154-Eur	Biorb	recombinant
orb80605	Human Trefoil Factor-1 His Tag protein TFF-1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 70 amino acids (25-84) which includes 10 amino acid His Ta	5	154-Eur	Biorb	recombinant
orb80606	Human Trefoil Factor-2 His Tag protein TFF-2 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 116 amino acids (24-129) which includes 10 amino acid His	5	154-Eur	Biorb	recombinant
orb80340	Human GDF10 protein GDF10 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 111 amino acids (369-478 a.a.) and having total molecular mass of 12.5 kDa. G	5	154-Eur	Biorb	recombinant
orb81426	Human Tumor Protein Translationally-Controlled 1 protein TPT1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 210 amino acids (1-172 a.a.) and having a	5	154-Eur	Biorb	recombinant
orb80958	Human Bcl2-NWGR protein Bcl-2 Des NWGR domain (143-146 residues) Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 214 amino acids 1-142 and 147-218.The B	2	154-Eur	Biorb	recombinant
orb80330	Human Galectin 3 protein LGALS3 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 250 amino acids and having a molecular mass of 26 kDa.The LGALS3 is pur	10	154-Eur	Biorb	recombinant
orb90235	Human Cyclophilin H protein PPIH Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 177 amino acids (1-177) and having a molecular mass of 19.2 kDa. PPIH	5	154-Eur	Biorb	recombinant
orb80328	Human Galectin 1 protein LGALS1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 134 amino acids and having a molecular mass of 14.5 kDa.The LGALS1 is p	10	154-Eur	Biorb	recombinant
orb80658	Human Fractalkine His Tag protein Fractalkine Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 76 amino acids fragment (25-100) having total molecular m	2	154-Eur	Biorb	recombinant
orb90063	Human Cyclophilin D protein Cyclophilin D Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 390 amino acids and having a molecular mass of 42.9 kDa. Cycl	5	154-Eur	Biorb	recombinant
orb81374	Human Syntaphilin protein SNPH Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 444 amino acids (1-424) and having a molecular mass of 48.2 kDa.The SNPH	10	154-Eur	Biorb	recombinant
orb81411	Human Transcription Elongation Factor Polypeptide protein TCEB2 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 118 amino acids (1-118) and having a mol	10	154-Eur	Biorb	recombinant
orb80382	Human HGF Chain protein HGF-B Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 234 amino acids fragment (495-728) having molecular weight of 34kDa and f	2	154-Eur	Biorb	recombinant
orb80381	Human HGF Chain protein HGF-A Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 463 amino acids fragment (32-494) having total molecular weight of 57.8kD	2	154-Eur	Biorb	recombinant
orb81380	Human SOX9 150 a.a. protein SOX9 Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 150 amino acids (1-150 a.a.) fused to GST tag and having total molecul	2	277-Eur	Biorb	recombinant
orb90095	Human FK506 Binding Protein 3 protein FKBP3 produced in E.coli is a single, non-glycosylated polypeptide chain containing 224 amino acids (1-224 a.a.) and having a molecular mass of 25.1 kDa. FKBP3 is	5	154-Eur	Biorb	recombinant
orb81288	Human Beta-Microseminoprotein PSP94 Recombinant Human produced in E.coli is a single, non-glycosylated, polypeptide chain containing 104 amino acids and having a molecular mass of 12 kDa. The PSP94 is	2	154-Eur	Biorb	recombinant
orb90096	Human FK506 Binding Protein 4 protein FKBP4 produced in E.coli is a single,non-glycosylated polypeptide chain containing 479 amino acids (1-459 a.a.) and having a molecular mass of 53.9 kDa.FKBP4 is f	10	154-Eur	Biorb	recombinant
orb80280	Human beta NGF CHO protein NGF-beta Human Recombinant produced in CHO is homodimer, glycosylated, polypeptide chain containing identical 120 amino acids and having a molecular mass of 16,950 Dalton.Th	5	154-Eur	Biorb	recombinant
orb81510	Human Heat Shock 22 kDa Protein-8 His tag protein HSPB8 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 216 amino acids (1-196 a.a.) and having a molecu	2	154-Eur	Biorb	elisa
orb81446	Human Thioredoxin protein Thioredoxin Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 105 amino acids and having a molecular mass of 11.7 kDa. For rese	100	293-Eur	Biorb	recombinant
orb80942	Human Beta Glycoprotein-I protein b2 Glycoprotein-I Human Recombinant produced in SF9 is glycosylated, polypeptide chain containing 326 amino acids and having a molecular mass of 38,200 Dalton (exclud	5	154-Eur	Biorb	recombinant
orb81373	Human SNAP Associated protein SNAPIN Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 156 amino acids (1-136) and having a molecular mass of 17 kDa. SNAP	10	154-Eur	Biorb	recombinant
orb81365	Human SMAC_DIABLO protein Smac_Diablo Human Recombinant fused to N-terminal T7-Tag produced in E.coli is a single, non-glycosylated polypeptide chain containing 199 amino acids and having a molecular	5	154-Eur	Biorb	recombinant
orb90117	Human Glutaredoxin 1 protein Glutaredoxin Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 106 amino acids having a molecular mass of 11.7 kDa. For rese	10	154-Eur	Biorb	recombinant
orb80869	Human S-phase Kinase-Associated Protein Isoform A protein Recombinant Human SKP1 produced in E.coli is a single, non-glycosylated polypeptide chain containing 160 amino acids (1-160 a.a.) and having a	5	154-Eur	Biorb	recombinant
orb80011	Human Betacellulin protein Betacellulin Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 80 amino acids and having a molecular mass of 9 kDa. Betacellul	5	154-Eur	Biorb	recombinant
orb90263	Human Fibroblast Activation Protein Alpha protein Seprase Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 203 amino acids (559-761 a.a.) and having tot	2	277-Eur	Biorb	recombinant
EIAAB12842	3-keto acyl-CoA synthase Elovl5,Elongation of very long chain fatty acids protein 5,Elovl5,Fatty acid elongase 1,Rat,Rattus norvegicus,rELO1		1191-Eur	EIAab
orb81124	Human Fission-1 protein FIS1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 142 amino acids (1-122 a.a.) and having a molecular mass of 16.3 kDa. FIS1	10	154-Eur	Biorb	recombinant
orb80884	Human Tyr-3_Trp- Monooxygenase Activation Protein, Tau protein YWHAQ Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 245 amino acids (1-245) and having	5	154-Eur	Biorb	recombinant
orb80638	Human VEGF (121) His Tag protein VEGF-121 Human Recombinant produced in E.coli is a double, non-glycosylated, polypeptide chain containing total of 142 amino acids and having a molecular mass of 16.3	2	154-Eur	Biorb	recombinant
orb90013	Human Acyl-CoA Dehydrogenase, Very Long Chain protein ACADVL Human Recombinant produced in E.coli is non-glycosylated, polypeptide chain containing 636 amino acids (41-655 a.a.) and having a molecular	2	154-Eur	Biorb	recombinant
orb80271	Human BLyS His tag protein BLyS Human Recombinant fused to His tag at N-terminus produced in E.coli is a single, non-glycosylated polypeptide chain containing 190 amino acids and having a molecular ma	5	154-Eur	Biorb	recombinant
orb90271	Beta Lactamase protein Beta-Lactamase TEM precursor Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 263 amino acids and having a molecular mass of 29 kDa. Bet	1 mg	228-Eur	Biorb	recombinant
orb90164	Human Lecithin-Cholesterol Acyltransferase HEK protein LCAT Human Recombinant produced in HEK is a single, glycosylated, polypeptide chain containing 429 amino acids (25-440) which includes 13 amino a	2	154-Eur	Biorb	recombinant
orb81521	Human STIP1 Homology and U-Box Containing Protein 1 protein STUB1 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 303 amino acids and having a molecular	10	154-Eur	Biorb	recombinant
orb81471	Human Vacuolar Protein Sorting 28 protein VPS28 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 221 amino acids (1-221 a.a.) and having a molecular mas	10	154-Eur	Biorb	recombinant
orb80450	Human IL16 His tag protein IL16 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 150 amino acids and having a molecular mass of 15 kDa. The IL-16 is fuse	5	154-Eur	Biorb	recombinant
orb81465	Human VAMP Associated Protein A, 33kDa protein VAPA Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 264 amino acids (1-227 a.a.) and having a molecular	5	154-Eur	Biorb	recombinant
AS05 096	Antibody: TOP2 | DNA topoisomerase II, Immunogen: The C-terminal 153 amino acids of the Arabidopsis thaliana Topoisomerase II (At3g23890, protein accesion number P30182) with an N-terminal hexahistidi	200	337-Eur	Gentaur
orb80073	Human IL13 protein IL13 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 112 amino acids and having a molecular mass of 12 kDa. The IL-13 is purified by	2	154-Eur	Biorb	recombinant
orb80442	Human IL13 His tag protein IL13 His Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 112 amino acids fragment (21-132) having molecular weight of 12.84	2	154-Eur	Biorb	recombinant
orb81204	Human Tyrosine-Protein Kinase LYN protein LYN Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 100 amino acids (1-100 a.a.) having total Mw of 37kDa. Hu	2	277-Eur	Biorb	recombinant
orb80475	Human IL28A protein IL28A human recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 175 amino acids and having a molecular mass of 19.6 kDa. For research use onl	5	154-Eur	Biorb	recombinant
orb80642	Human VEGF B protein VEGFB Human Recombinant produced in E.coli is a double, non-glycosylated, polypeptide chain containing 207 amino acids (22-207) and having a molecular mass of 21.6 kDa.The VEGFB i	2	154-Eur	Biorb	recombinant
orb81106	Human FABP7 protein FABP7 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 132 amino acids and having a molecular mass of 14 kDa. For research use only.	5	154-Eur	Biorb	recombinant
orb80449	Human IL16 protein IL16 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 130 amino acids and having a molecular mass of 13.5 kDa. The IL-16 is purified b	2	154-Eur	Biorb	recombinant
orb80816	Human VEGF receptor-3 Fc Chimera protein Soluble FLT4 Human Recombinant fused with the Fc part of human IgG1 produced in baculovirus is monomeric, glycosylated, polypeptide containing 774 amino acids	2	154-Eur	Biorb	recombinant
AS10 652	Antibody: Cu_ZnSOD | Cu_Zn superoxide dismutase, Immunogen: 15 amino acids synthetic peptide designed from olive pollen cytosolic Cu_Zn cDNA consensus sequences (GenBank Accessions EU250757 to EU25079	200	337-Eur	Gentaur
AS10 1581	Antibody: Deg2 | chloroplastic DegP-type serine protease 2 , Immunogen: KLH-conjugated synthetic peptide (amino acids 69 – 83) against Arabidopsis thaliana DegP protein At2g47940, Host: rabbit,	200 ul	381-Eur	Gentaur
SMC-201D	DNMT1 Antibody Monoclonal, Clone number: 4G11-C7 Host: Mouse, Isotype: IgG1 Kappa Immunogen: Raised against a synthetic peptide corresponding to amino acids 637-650 of human DNMT1 (Gene accession numb	100ug	279-Eur	Stressmarq
SMC-374D	Co-Rest_RCOR1 Antibody Monoclonal, Clone number: S72-8 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 109-293 of human Co-Rest, accession number NP_055971. Includes ELM2 and SANT do	100ug	279-Eur	Stressmarq
orb81321	Human Serum Albumin, Plant protein HSA Human Recombinant produced in Plant is non-glycosylated, polypeptide chain containing 585 amino acids and having a molecular mass of 67 kDa.The optimum concentra	10 mg	195-Eur	Biorb	recombinant
orb80758	Human Stanniocalcin-1 protein Stanniocalcin-1 Human Recombinant produced in 293 cell line is a single, glycosylated, polypeptide chain containing 240 amino acids and having total molecular mass of 25.	2	154-Eur	Biorb	recombinant
orb80024	Mouse FGF basic protein FGF basic Mouse Recombinant (FGF-2) produced in E.coli is a single, non-glycosylated, polypeptide chain containing 145 amino acids and having a molecular mass of 16320 Dalton.T	10	154-Eur	Biorb	recombinant
orb80637	Human VEGF (121) Sf9 protein VEGF-121 Human Recombinant produced in insect cells as an 18kDa homodimer, is glycosylated, polypeptide chain containing 121 amino acids and having a molecular mass of app	2	154-Eur	Biorb	recombinant
orb81339	Human S100 Calcium Binding Protein A9 protein S100A9 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 122 amino acids (1-114 a.a.) and having a molecula	5	154-Eur	Biorb	recombinant
orb81338	Human S100 Calcium Binding Protein A8 protein S100A8 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 93 amino acids (1-93 a.a.) and having a molecular	5	154-Eur	Biorb	recombinant
orb80633	Human VEGF CHO protein VEGF Human Recombinant produced in CHO cells is a double, glycosylated, polypeptide chain containing 165 amino acids and migrates as 44 kDa in SDS-PAGE under non-reducing condit	2	154-Eur	Biorb	recombinant
orb80598	Human Serum Amyloid (APO-SAA1) protein SAA1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 125 amino acids (19-122 a.a.) and having total molecular ma	10	154-Eur	Biorb	recombinant
SMC-363D	SH3GL1 Antibody Monoclonal, Clone number: S51-1 Host: Mouse, Isotype: IgG1 Immunogen: Synthetic peptide amino acids 287-302 od rat SH3GL1, accession number AAH70893.	100ug	279-Eur	Stressmarq
orb81407	Human Tachykinin-3 protein TAC3 Human Recombinant fused with 20 amino acid His tag at N-terminus produced in E.coli is a single, non-glycosylated, polypeptide chain containing 125 amino acids (17-121	5	154-Eur	Biorb	recombinant
orb81370	Human Synaptosomal-associated protein 25kDa protein SNAP25 Human Recombinant fused to N-terminal His-Tag produced in E.coli is a single, non-glycosylated polypeptide chain containing 226 amino acids a	10	154-Eur	Biorb	recombinant
orb81346	Human S100 Calcium Binding Protein P His tag protein S100P Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 115 amino acids (1-95a.a.) and having a mole	5	154-Eur	Biorb	recombinant
orb80471	Mouse IL22 protein IL22 Mouse Recombinant produced in E.coli is a single, non-glycosylated homodimeric polypeptide chain containing 147 amino acids and having a molecular mass of 16.7 kDa. The Murine	2	154-Eur	Biorb	recombinant
orb80469	Mouse IL20 protein IL20 Mouse Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 152 amino acids and having total molecular mass of 17,584 Dalton. The IL-20 is p	2	154-Eur	Biorb	recombinant
orb80051	Mouse IL1 beta protein IL1 beta Mouse Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 153 amino acids and having a molecular mass of 17500 Dalton. The IL-1b is purifie	2	154-Eur	Biorb	recombinant
orb80550	Human Progranulin protein Progranulin Human Recombinant fused to FLAG at C-terminus produced in HEK is a single, glycosylated, polypeptide chain containing 593 amino acids and having a molecular mass	2	154-Eur	Biorb	recombinant
SMC-134C	SAP102 Antibody Monoclonal, Clone number: S19-2 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 1-120 ofd rat SAP102 (accession number Q62936)	25ug	110-Eur	Stressmarq
orb80114	Human Thrombopoietin protein Thrombopoietin Human Recombinant produced in E.coli is a single, non-glycosylated soluble polypeptide chain containing 174 amino acids and having a molecular mass of 18608	2	154-Eur	Biorb	recombinant
SMC-134D	SAP102 Antibody Monoclonal, Clone number: S19-2 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 1-120 ofd rat SAP102 (accession number Q62936)	100ug	226-Eur	Stressmarq
SMC-385D	PICK1 Antibody Monoclonal, Clone number: S20-8 Host: Mouse, Isotype: IgG2a Immunogen: Fusion protein amino acids 101-30 of rat PICK1, accession number AAG48152	100ug	279-Eur	Stressmarq
SMC-315D	TrpC4 Antibody Monoclonal, Clone number: S77-15 Host: Mouse, Isotype: IgG1 Immunogen: Synthetic peptide amino acids 930-947 of rat TrpC4, accession number O35119	100ug	279-Eur	Stressmarq
orb80286	Bovine Betacellulin protein Betacellulin Bovine Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 80 amino acids and having a molecular mass of 9003 Dalton. Be	5	154-Eur	Biorb	recombinant
orb81495	E.coli GroEL (HSP60) protein Recombinant GroEL produced in E.coli is a single, non-glycosylated polypeptide chain containing 548 amino acids and having a molecular mass of 57.3kDa. For research use on	10	154-Eur	Biorb	recombinant
orb81255	Human Parkinson Disease Protein 7 protein PARK7 Human Recombinant fused to N-terminal His-Tag produced in E.coli is a single, non-glycosylated polypeptide chain containing 225 amino acids and having a	5	154-Eur	Biorb	recombinant
orb81280	Human Peripheral Myelin Protein-2 His tag protein PMP2 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 132 amino acids and having a molecular mass of 19	5	154-Eur	Biorb	recombinant
orb80125	Mouse Eotaxin 2 protein CCL24 Mouse Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 93 amino acids and having a molecular mass of 10.3 kDa. The CCL24 is purif	5	154-Eur	Biorb	recombinant
orb81060	Mouse Cystatin-C protein Cystatin-C Murine Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 134 amino acids and having a molecular mass of 15kDa. The Mouse Cy	2	154-Eur	Biorb	recombinant
orb80122	Mouse CXCL5 protein Epithelial Neutrophil-Activating Protein 78 Mouse Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 93 amino acids and having a molecular m	5	154-Eur	Biorb	recombinant
orb81379	Human SOX9 protein SOX9 Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 195 amino acids (316-510 a.a.) fused to GST tag and having total molecular mass	2	277-Eur	Biorb	recombinant
orb80544	Human PDGF BB protein Platelet-Derived Growth Factor BB Human Recombinant is homodimeric, non-glycosylated, polypeptide chain containing 109 amino acids and having a molecular mass of 24.3 kDa. PDGF-B	2	154-Eur	Biorb	recombinant
orb82763	Human PDI protein Recombinant human PDI is a single, non-glycosylated polypeptide chain containing 503 amino acids and a N-terminal 6xHis tag. Protein disulfide isomerases (PDIs) constitute a family o	1 mg	1047-Eur	Biorb	recombinant
orb80880	Human Tyr-3_Trp-5 Monooxygenase Activation Protein, Epsilon protein YWHAE Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 255 amino acids (1-255) and h	5	154-Eur	Biorb	recombinant
SMC-305D	HCN2 Antibody Monoclonal, Clone number: S71-37 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 761-863 of rat HCN2, accession number Q9JKA9	100ug	279-Eur	Stressmarq
orb80883	Human Tyr-3_Trp-5 Monooxygenase Activation Protein, ETA protein YWHAH Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 266 amino acids and having a mole	5	154-Eur	Biorb	recombinant
orb80882	Human Tyr-3_Trp-5 Monooxygenase Activation Protein, Gamma His Tag protein YWHAG Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 246 amino acids (2-247)	2	154-Eur	Biorb	recombinant
SMC-336D	SHANK3 Antibody Monoclonal, Clone number: S69-46 Host: Mouse, Isotype: IgG2b Immunogen: Synthetic peptide amino acids 840-857 of rat Shank3, accession number Q9JLU4	100ug	279-Eur	Stressmarq
orb80881	Human Tyr-3_Trp-5 Monooxygenase Activation Protein, Gamma protein YWHAG Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 247 amino acids (1-247) and hav	5	154-Eur	Biorb	recombinant
orb80885	Human Tyr-3_Trp- Monooxygenase Activation Protein, Sigma protein Stratifin Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 248 amino acids (1-248) and	5	154-Eur	Biorb	recombinant
orb81279	Human Peripheral Myelin Protein-2 protein PMP2 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 132 amino acids and having a molecular mass of 14.9 kDa.	5	154-Eur	Biorb	recombinant
orb80127	Mouse Exodus 2 protein Exodus 2 Mouse Recombinant produced in E.coli as single, non-glycosylated, polypeptide chain containing 110 amino acids and having a molecular mass of 12 kDa. The CCL21 is purif	5	154-Eur	Biorb	recombinant
orb81335	Human S100 Calcium Binding Protein A4 His Tag protein S100A4 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 121 amino acids (1-101) and having a molecu	5	154-Eur	Biorb	recombinant
AS10 1614	Antibody: SppA1 | signal peptide peptidase (cyanobacterial) (200 ul), Immunogen: synthetic peptide (amino acids 305 - 320) specific for SppA1 protease from Synechocystis sp. PCC 6803, P73689, Hos	200 ul	381-Eur	Gentaur
SMC-325D	Chapsyn-110 Antibody Monoclonal, Clone number: S18-30 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 1-852 of rat Chapsyn-110; accession number Q63622	100ug	279-Eur	Stressmarq
orb81494	E.coli Thiol Disulfide Interchange protein Recombinant DsbG produced in E.coli is a single, non-glycosylated polypeptide chain containing 232 amino acids and having a molecular mass of 25.8 kDa. DsbG	5	154-Eur	Biorb	recombinant
orb81493	E.coli Thiol Disulfide Interchange protein Recombinant DsbE produced in E.coli is a single, non-glycosylated polypeptide chain containing 161 amino acids and having a molecular mass of 18.1 kDa. DsbE	5	154-Eur	Biorb	recombinant
orb80759	Human Stanniocalcin-2 protein Stanniocalcin-2 Human Recombinant produced in 293 cell line is a single, glycosylated, polypeptide chain containing 289 amino acids and having total molecular mass of 32	2	154-Eur	Biorb	recombinant
orb81311	Human Recoverin protein Recoverin Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 200 amino acids having a molecular mass of 23kDa. For research use onl	10	154-Eur	Biorb	recombinant
orb81304	Human RAP1A, Member RAS Oncogene Family protein RAP1A Recombinant E.coli produced in E.coli is a single, non-glycosylated polypeptide chain containing 201 amino acids (1-181 a.a.) and having a molecul	2	154-Eur	Biorb	recombinant
orb80747	Human Oxyntomodulin protein Oxyntomodulin Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 37 amino acids and having a molecular mass of 4420.86 Dalton.	10	154-Eur	Biorb	recombinant
orb81369	Human Synaptosomal-associated protein 23kDa protein SNAP23 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 211 amino acids and having a molecular mass o	5	154-Eur	Biorb	recombinant
orb81277	Human PIN2-Interacting Protein 1 protein Recombinant Human PINX1 produced in E.coli is a single, non-glycosylated polypeptide chain containing 348 amino acids (1-328 a.a) and having a molecular mass o	5	154-Eur	Biorb	recombinant
orb81466	Human Vascular cell adhesion molecule 1 protein VCAM1 Human Recombinant is expressed in E.coli containing 674 amino acids (a.a. 25-698) fused to an amino terminal hexahistidine tag, having total MW of	2	154-Eur	Biorb	recombinant
orb80692	Human Rantes His Tag protein Rantes Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 68 amino acids fragment (24-91) having total molecular mass of 17.5	2	154-Eur	Biorb	recombinant
orb81749	Epstein-Barr Virus (HHV-4) Mosaic EBNA1 protein The E.coli derived recombinant mosaic protein contains the HHV-4 EBNA regions, 1-90, 408-498 amino acids, the Mw is 46kDa (including 26kDa GST tag). For	100	228-Eur	Biorb	recombinant
orb80648	Human Visfatin protein Visfatin Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 348 amino acids and having 11 N-terminal flag tag The total molecular m	5	154-Eur	Biorb	recombinant
orb80547	Human PEDF His tag protein PEDF Human Recombinant produced in E.coli containing natural variant M72T is a single, non-glycosylated, polypeptide chain containing 420 amino acids (20-418 a.a.) and havin	5	154-Eur	Biorb	recombinant
orb80929	Bovine Aprotinin protein Aprotinin is natural proteinase inhibitor polypeptide consisting of fifty-eight amino acids {C 284 432 84 79 7} arranged in single polypeptide chain, cross-linked by three dis	100 mg	228-Eur	Biorb	bovine
orb80007	Human BMP2 protein BMP2 Human Recombinant produced in E.coli is homodimeric, non-glycosylated, Polypeptide chain containing 115 amino acids and having a molecular mass of 26018 Dalton. The BMP-2 is pu	2	154-Eur	Biorb	recombinant
orb80570	Rat Prolactin Soluble Receptor protein Prolactin Receptor Rat Extra Celleular Domain Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 206 amino acids and having a molec	10	154-Eur	Biorb	recombinant
orb80931	Human Aprataxin protein APTX Human Recombinant fused to 37 amino acid His Tag at N-terminal produced in E.coli is a single, non-glycosylated, polypeptide chain containing 205 amino acids (1-168 a.a.)	2	154-Eur	Biorb	recombinant
orb81114	Human Ferredoxin-1 protein FDX1 Human Recombinant fused with 15 amino acid T7 tag at N-terminus produced in E.coli is a single, non-glycosylated, polypeptide chain containing 139 amino acids (61-184 a	5	154-Eur	Biorb	recombinant
orb80039	Human Interferon-alpha 2b protein Interferon-a 2b Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 166 amino acids and having a molecular mass of 19400	20	154-Eur	Biorb	recombinant
orb82835	Rhesus macaque IL6 protein Recombinant Rhesus Macaque IL6 is a single non-glycosylated polypeptide chain containing 186 amino acids. IL6 is a pleiotropic cytokine that plays an important role in host	1 mg	3143-Eur	Biorb	recombinant
orb80480	Human IL33 His Tag protein Human IL33 Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 159 amino acids C-terminal fragment (112-270) having molecular weight o	2	154-Eur	Biorb	recombinant
orb90159	Human Kallikrein-7 protein KLK7 Human Recombinant produced in HEK-293 cells is a single, glycosylated, polypeptide chain containing 231 amino acids with molecular weight of 30 kDa. The KLK7 is purifie	2	154-Eur	Biorb	recombinant
orb80080	Human IL21 protein IL21 Human Recombinant produced in E.coli is a single, non-glycosilated polypeptide chain containing 133 amino acids and having total molecular mass of 15,463 Dalton. The IL-21 is p	2	154-Eur	Biorb	recombinant
orb90147	Human HRAS-Like Suppressor (PLA2G16) protein HRASLS3 Human Recombinant amino produced in E.coli is a single, non-glycosylated polypeptide chain containing 133 amino acids (1-133) having a molecular ma	10	154-Eur	Biorb	recombinant
orb80021	Human FGF acidic protein FGF acidic Human Recombinant (FGF-1) produced in E.coli is a single, non-glycosylated, polypeptide chain containing 141amino acids and having a molecular mass of 15967 Dalton.	10	154-Eur	Biorb	elisa
orb80050	Human IL1 beta protein Human IL1 beta Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 153 amino acids and having a molecular mass of 17000 Dalton.The IL-1b is purified	2	154-Eur	Biorb	recombinant
29-355	Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. Lysyl-tRNA synthetase is a homodimer localized to the cytoplasm which belongs to the class II family	0.05 mg	632-Eur	Prosci	rna
orb80006	Human BLyS Receptor protein B Lymphocyte Stimulator Receptor Human Recombinant extracellular produced in E.coli is a single, non-glycosylated polypeptide chain containing 76 amino acids and having a m	5	154-Eur	Biorb	recombinant
orb80124	Human Eotaxin 2 protein CCL24 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 78 amino acids and having a molecular mass of 8.8 kDa. The CCL24 is purifi	5	154-Eur	Biorb	recombinant
orb80656	Human Eotaxin 3 protein Eotaxin 3 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 72 amino acids (24-94 a.a.) and having total molecular mass of 8.5kDa	10	154-Eur	Biorb	recombinant
orb80048	Human IL1 alpha protein Human IL1 alpha Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 159 amino acids and having a molecular mass of 18022 Dalton. The IL-1	2	154-Eur	Biorb	recombinant
orb80685	Human Macrophage Inflammatory protein-3 (CCL23), T7 Tag protein CCL19 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 93 amino acids (22098 a.a.) and h	5	154-Eur	Biorb	recombinant
orb90256	Human Protein Tyrosine Phosphatase Type IVA Member 3 protein Recombinant Human PTP4A2 produced in E.coli is a single, non-glycosylated polypeptide chain containing 203 amino acids (1-167 a.a.) and hav	5	154-Eur	Biorb	recombinant
orb90241	Human Protein Phosphatase Inhibitor-1 protein PPP1R1A Human Recombinant fused with His tag at C-terminus produced in E.coli is a single, non-glycosylated, polypeptide chain containing 179 amino acids	5	154-Eur	Biorb	recombinant
orb80487	Human Leptin His tag protein Leptin Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing amino acids 48-167 and having total molecular mass of 19 kDa includ	5	154-Eur	Biorb	recombinant
orb82736	Human KIT Ligand protein Recombinant Human KIT Ligand_Stem Cell Factor-alpha is a single, non-glycosylatedpolypeptide chain containing 165 amino acids.KIT Ligand (KITLG) is the recently identified lig	1 mg	2472-Eur	Biorb	recombinant
orb80360	Rat Growth Hormone protein Growth Hormone Rat Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 190 amino acids and having a molecular mass of 21810 Dalton. GH	100	359-Eur	Biorb	recombinant
orb80043	Rat Interferon-gamma protein Interferon-gamma Rat Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 135 amino acids and having a molecular mass of 15609 Dalton	20	154-Eur	Biorb	recombinant
orb80682	Rat MIP1 alpha protein Macrophage Inflammatory Protein-1 alpha Rat Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 69 amino acids and having a molecular mass	5	154-Eur	Biorb	recombinant
orb90141	Human Histone Deacetylase protein HDAC1 Human Recombinant fused with amino acid His tag at C-terminus produced in Hi-5 is a single, glycosylated, polypeptide chain containing 490 amino acids (1-482 a.	5	154-Eur	Biorb	recombinant
orb80327	Human Follistatin protein Follistatin Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 288 amino acids and having total molecular mass of 31.5kDa.The FST	5	154-Eur	Biorb	recombinant
orb90044	Human Biliverdin Reductase B protein BLVRB Human Recombinant amino produced in E.coli is a single, non-glycosylated polypeptide chain containing 206 amino acids having a molecular mass of 22.1 kDa.The	10	154-Eur	Biorb	recombinant
orb90094	Human FK506 Binding Protein 2 protein FKBP2 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 122 amino acids (22-142 a.a.) and having a molecular mass o	2	154-Eur	Biorb	recombinant
orb80128	Human GRO-alpha protein GRO Alpha Human Recombinant produced in E.coli is a single,non-glycosylated, polypeptide chain containing 73 amino acids and having a molecular mass of 7811 Dalton. The GRO-alp	5	154-Eur	Biorb	recombinant
orb90052	Human Caspase-3 protein CASP3 Human Recombinant produced in E.coli is a double, non-glycosylated, polypeptide chain cotaning 258 amino acids and having a molecular mass of 29.7 kDa.The Caspase-3 is fu	2	195-Eur	Biorb	recombinant
orb80070	Human IL11 protein IL11 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 179 amino acids and having a molecular mass of 19256.29 Dalton. The IL-11 is pur	2	154-Eur	Biorb	recombinant
orb80067	Human IL10 protein IL10 Human Recombinant produced in E.coli is non covalent dimer of polypeptide chains containing 161 amino acids each and having a molecular mass of 18606.29 Dalton.The IL-10 is pur	2	154-Eur	Biorb	recombinant
orb80437	Human IL10 His tag protein IL10 Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 181 amino acids fragment (19-178) and having total molecular mass of 21	2	154-Eur	Biorb	recombinant
orb80403	Human IGFBP6 protein IGFBP6 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing amino acids 148-240 and having a molecular mass of 20 kDa including 4kDa Hi	5	154-Eur	Biorb	recombinant
orb90084	Human Enolase-1 protein The ENO1 Human Recombinant protein is a single, non-glycosilated polypeptide chain produced in E.coli, having molecular weight of 47.1kDa and containing 434 amino acids (1-434	5	154-Eur	Biorb	recombinant
orb81513	Human Heat Shock Protein 47 protein Recombinant Human HSP47 produced in E.coli is a single, non-glycosylated polypeptide chain containing 439 amino acids (18-418 a.a.) and having a molecular mass of 4	10	154-Eur	Biorb	recombinant
orb80072	Human IL12 protein IL12 Human Recombinant produced in CHO is glycosylated disulfide linked heterodimeric polypeptide containing 503 amino acids and having molecular weight of 75 kDa comprised of disul	2	154-Eur	Biorb	recombinant
orb90097	Human FK506 Binding Protein 6 protein FKBP6 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 347 amino acids (1-327 a.a.) and having a molecular mass of	2	154-Eur	Biorb	recombinant
orb80657	Human Fractalkine protein Fractalkine Human Recombinant- produced in E.coli is a single,non-glycosylated, polypeptide chain containing 76 amino acids and having a molecular mass of 8638 Dalton. The Fr	5	154-Eur	Biorb	recombinant
orb81148	Human Gammalpha Synuclein protein g-Synuclein Human Recombinant produced in E.coli is a single,non-glycosylated polypeptide chain containing 127 amino acids and having a molecular mass of 13,300 Dalto	20	154-Eur	Biorb	recombinant
orb90192	Human Histidine NADH Dehydrogenase Fe-S Protein 4 protein NDUFS4 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 134 amino acids (43-175 a.a.) and havi	5	154-Eur	Biorb	recombinant
orb80464	Human IL18 His Tag protein IL18 Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 157 amino acids fragment (37-193) having molecular weight of 20kDa and	2	154-Eur	Biorb	recombinant
orb80077	Human IL17A protein IL17A Human Recombinant produced in E.coli is homodimeric, non-glycosylated polypeptide chain containing total of 264 amino acids (2 chains of 132 aa) and having a molecular mass o	5	154-Eur	Biorb	recombinant
orb90138	Human Glycogenin-1 protein GYG1 Human Recombinant fused with 32 amino acid His-T7 tag at N-terminus produced in E.coli is a single, non-glycosylated, polypeptide chain containing 365 amino acids (1-33	5	154-Eur	Biorb	recombinant
orb80452	Human IL17A His Tag protein IL17A Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 132 amino acids fragment (24-155) having molecular weight of 21.5kDa	2	154-Eur	Biorb	recombinant
orb81144	Human Geminin protein Geminin Human Recombinant fused to N-terminal His-Tag produced in E.coli is a single, non-glycosylated polypeptide chain containing 245 amino acids and having a molecular mass of	5	154-Eur	Biorb	recombinant
orb80444	Human IL15 His tag protein IL15 His Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 123 amino acids fragment (49-162) having total molecular weight of	2	154-Eur	Biorb	recombinant
orb90030	Human Aldolase-A protein ALDOA Human Recombinant fused to 20 amino acid His Tag at N-terminal produced in E.coli is a single, non-glycosylated, polypeptide chain containing 384 amino acids (1-364 a.a.	5	154-Eur	Biorb	recombinant
orb90099	Human FK506 Binding Protein Like protein FKBPL Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 357 amino acids (1-349 a.a.) and having a molecular mass	1	154-Eur	Biorb	recombinant
orb81511	Human Heat Shock Protein 27 protein Recombinant Human HSP-27 produced in E.coli is a single, non-glycosylated polypeptide chain containing 205 amino acids and having a molecular mass of 22.7 kDa. Hsp2	10	154-Eur	Biorb	recombinant
orb80121	Human CXCL5 protein Epithelial Neutrophil-Activating Protein 78 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 74 amino acids and having a molecular m	5	154-Eur	Biorb	recombinant
orb80978	Human Complement C1q TNF-Related Protein 6 protein C1QTNF6 Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 242 amino acids and having a molecular mass	2	154-Eur	Biorb	recombinant
orb80530	Human Neuregulin-1_Heregulin-b2 protein Recombinant Human Neuregulin-1 beta produced in E.coli is a single, non-glycosylated, polypeptide chain containing 61 amino acids and having total molecular mas	10	154-Eur	Biorb	recombinant
orb80156	Human NAP protein Neutrophil Activating Protein-2 Human Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 70 amino acids and having a molecular mass of 7609 Dalton. The	2	154-Eur	Biorb	recombinant
orb80981	Human Calcium Binding Protein 39 protein CAB39 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 361 amino acids (1-341 a.a.) and having a molecular mass	2	154-Eur	Biorb	recombinant
orb81225	Human Myosin Light Chain protein MYL2 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 186 amino acids (1-166) and having a molecular mass of 20.9 kDa.	5	154-Eur	Biorb	recombinant
orb81422	Human Coagulation Factor III protein Tissue factor Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 219 amino acids of the extracellular domain (33-251)	2	154-Eur	Biorb	recombinant
orb80976	Human Complement C1q TNF-Related Protein 1 protein C1QTNF1 Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 266 amino acids and having a molecular mass	2	154-Eur	Biorb	recombinant
orb80155	Human MIP5 protein Macrophage Inflammatory Protein-5 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 92 amino acids and having a molecular mass of 10.1	5	154-Eur	Biorb	recombinant
orb80628	Mouse Thrombopoietin protein Thrombopoietin Mouse Recombinant produced in E.coli is a single, non-glycosylated soluble polypeptide chain containing 174 amino acids and having a molecular mass of 18704	2	154-Eur	Biorb	recombinant
orb80532	Mouse Neurotrophin-3 protein Neurotrophin-3 Mouse Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 119 amino acids and having a molecular mass of 13606.29 Dalt	2	154-Eur	Biorb	recombinant
orb90098	Human FK506 Binding Protein 14 protein FKBP14 Recombinant E.coli produced in E.coli is a single, non-glycosylated polypeptide chain containing 213 amino acids (20-211 a.a.) and having a molecular mass	5	154-Eur	Biorb	recombinant
orb80991	Human Calsequestrin protein CASQ2 Human Recombinant fused to 37 amino acid His Tag at N-terminal produced in E.coli is a single, non-glycosylated, polypeptide chain containing 417 amino acids (20-399	5	154-Eur	Biorb	recombinant
orb81344	Mouse S100 Calcium Binding Protein B protein S100B Mouse Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 92 amino acids (1-112 a.a.) and having a molecular ma	5	154-Eur	Biorb	recombinant
orb80979	Human Complement C1q TNF-Related Protein 7 protein C1QTNF7 Human Recombinant produced in E.coli is signle, non-glycosylated, Polypeptide chain containing 283 amino acids and having a molecular mass of	2	154-Eur	Biorb	recombinant
orb81062	Human CutA Divalent Cation Tolerance Homolog protein CUTA Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 156 amino acids (33-179 a.a.) and having a mo	5	154-Eur	Biorb	recombinant
orb80531	Human Neurotrophin-3 protein Neurotrophin-3 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 119 amino acids and having a molecular mass of 13606.29 Dalt	2	154-Eur	Biorb	recombinant
orb80783	Human Calcium and Integrin Binding 1 protein CIB1 Human Recombinant is a single, non-glycosylated polypeptide chain containing 211 amino acids and having a molecular mass of 23 kDa. CIB1 was overexpre	5	154-Eur	Biorb	recombinant
orb80044	Ovine Interferon-Tau protein Interferon-Tau Ovine Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 172 amino acids and having a molecular mass of 19914.7 Dalt	2	154-Eur	Biorb	recombinant
orb81050	Human Cornulin protein CRNN Human Recombinant fused to 20 amino acid His Tag at N-terminal produced in E.coli is a single, non-glycosylated, polypeptide chain containing 515 amino acids (1-495 a.a.) a	5	154-Eur	Biorb	recombinant
orb80009	Human BMP7 protein BMP7 Human Recombinant produced in E.coli is monomeric, non-glycosylated, polypeptide chain containing 139 amino acids and having a molecular mass of 15679.97 Dalton. The BMP-7 is p	2	154-Eur	Biorb	recombinant
orb80563	Rabbit Prolactin protein Prolactin Rabbit Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 200 amino acids and having a molecular mass of 23007 Dalton. The Por	10	154-Eur	Biorb	recombinant
orb81071	Human Dickkopf-Related Protein HEK protein DKK1 Human Recombinant produced in HEK-293 cells is a single, glycosylated, polypeptide chain containing 184 amino acids with molecular weight of 20.7 kDa th	2	154-Eur	Biorb	recombinant
orb80106	Human Trefoil Factor-3 protein TFF3 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 69 amino acids (22-80 a.a.) which includes 10 amino acid His Tag fu	5	154-Eur	Biorb	recombinant
orb80910	Human Angiostatin Kringles 1-3 protein Angiostatin Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 259 amino acids and having a molecular mass of approx	20	154-Eur	Biorb	recombinant
orb90205	Human Pregnancy-Associated Plasma Protein-1 protein PAPP-A Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 191 amino acids fragment (81-271) correspond	2	154-Eur	Biorb	recombinant
orb80299	Human EGF Pichia protein EGF Human Recombinant produced in Pichia Pastoris is a single, glycosylated, polypeptide chain containing 51 amino acids and having a molecular mass of 6KDa.The EGF is purifie	100	154-Eur	Biorb	recombinant
NU-809-BIOXX	Nucleic acids: Biotin-18-dCTP, pack Biotin-XX-5-Propargylamino-dCTP	200	235-Eur	Jena Bio
NU-851-RHO101	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - ATTO-Rho101	80	746-Eur	Jena Bio
NU-851-540Q	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - ATTO-540Q	40	746-Eur	Jena Bio
NU-803-BIOX	Nucleic acids: Biotin-11-dUTP, pack Biotin-X-5-aminoallyl-dUTP	200	235-Eur	Jena Bio
NU-809-BIOX	Nucleic acids: Biotin-11-dCTP, pack Biotin-X-5-Propargylamino-dCTP	200	235-Eur	Jena Bio
NU-809-BIO16	Nucleic acids: Biotin-16-dCTP, pack Biotin-16-Propargylamino-dCTP	200	235-Eur	Jena Bio
NU-851-THIO12	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - ATTO-Thio12	80	746-Eur	Jena Bio
NU-851-612Q	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - ATTO-612Q	40	746-Eur	Jena Bio
NU-851-580Q	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - ATTO-580Q	40	746-Eur	Jena Bio
NU-851-RHO12	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - ATTO-Rho12	80	746-Eur	Jena Bio
NU-851-647N	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - ATTO-647N	80	746-Eur	Jena Bio
NU-851-RHO13	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - ATTO-Rho13	80	746-Eur	Jena Bio
NU-851-RHO11	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - ATTO-Rho11	80	746-Eur	Jena Bio
NU-851-RHO14	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - ATTO-Rho14	80	746-Eur	Jena Bio
NU-851-RHO6G	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - ATTO-Rho6G	80	746-Eur	Jena Bio
NU-812-480XL	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - DY-480XL	40	746-Eur	Jena Bio
NU-812-485XL	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-2'_5'-bisphosphate - DY-485XL	40	746-Eur	Jena Bio
NU-832-540Q	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - ATTO-540Q	80	746-Eur	Jena Bio
NU-832-RHO13	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - ATTO-Rho13	80	746-Eur	Jena Bio
NU-832-RHO6G	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - ATTO-Rho6G	80	746-Eur	Jena Bio
NU-832-THIO12	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - ATTO-Thio12	80	746-Eur	Jena Bio
NU-832-RHO12	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - ATTO-Rho12	80	746-Eur	Jena Bio
NU-811-485XL	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - DY-485XL	40	746-Eur	Jena Bio
NU-832-RHO11	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - ATTO-Rho11	80	746-Eur	Jena Bio
TS 022	VITAMINS AMINO GROWTH SUPPLEMENT (VITAMINS & AMINO ACIDS MIXTURE) (DP) (Store below 8ºC)	5 vl	99-Eur	TitanBiotech
NU-803-BIOXX	Nucleic acids: Biotin-18-dUTP, pack Biotin-XX-5-aminoallyl-dUTP	200	235-Eur	Jena Bio
NU-832-RHO101	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - ATTO-Rho101	80	746-Eur	Jena Bio
NU-803-BIO16	Nucleic acids: Biotin-16-dUTP, pack Biotin-16-5-aminoallyl-dUTP	200	235-Eur	Jena Bio
NU-832-580Q	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - ATTO-580Q	80	746-Eur	Jena Bio
bs-1180P	Peptides: RhoA (RhoA protein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
NU-811-480XL	Nucleic acids: 8-[(6-Amino)hexyl]-amino-adenosine-3'_5'-bisphosphate - DY-480XL	40	746-Eur	Jena Bio
NU-832-612Q	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - ATTO-612Q	80	746-Eur	Jena Bio
NU-832-647N	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - ATTO-647N	80	746-Eur	Jena Bio
NU-832-RHO14	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - ATTO-Rho14	80	746-Eur	Jena Bio
AS10 1608	Antibody: HhoA | protease HhoA (300 ul), Immunogen: synthetic peptide (amino acids 120 – 134) specific for Synechocystis sp. PCC 6803 HhoA Sll1679, Host: rabbit, polyclonal, Confirmed react	300 ul	871-Eur	Gentaur
AS10 1617	Antibody: HhoB | protease HhoB (300 ul), Immunogen: synthetic peptide (amino acids 74 – 88) specific for Synechocystis sp. PCC 6803 HhoB Sll1427, Host: rabbit, polyclonal, Confirmed reactivity:	300 ul	871-Eur	Gentaur
AS10 1620	Antibody: HhoB | protease HhoB (100 ul), Immunogen: synthetic peptide (amino acids 74 – 88) specific for Synechocystis sp. PCC 6803 HhoB Sll1427, Host: rabbit, polyclonal, Confirmed reactivity:	100 ul	381-Eur	Gentaur
AS10 1619	Antibody: HhoA | protease HhoA (100 ul), Immunogen: synthetic peptide (amino acids 120 – 134) specific for Synechocystis sp. PCC 6803 HhoA Sll1679, Host: rabbit, polyclonal, Confirmed react	100 ul	381-Eur	Gentaur
orb80788	Human CDC28 protein kinase 2 protein CKS2 Human Recombinant fused to T7-Tag produced in E.coli is a single, non- glycosylated polypeptide chain containing 94 amino acids and having a molecular mass of	5	154-Eur	Biorb	recombinant
orb80279	Human beta NGF protein NGF-beta Human Recombinant produced in E.coli is non-covalently disulfide-linked homodimer, non-glycosylated, polypeptide chain containing identical 121 amino acids with molecul	5	154-Eur	Biorb	recombinant
orb80123	Human Eotaxin protein Eotaxin Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 74 amino acids and having a molecular mass of 8345.9 Dalton. The CCL11 is	5	154-Eur	Biorb	recombinant
orb80126	Human Exodus 2 protein Exodus 2 Human Recombinant produced in E.coli as single, non-glycosylated, polypeptide chain containing 111 amino acids and having a molecular mass of 12219 Dalton. The CCL21 is	5	154-Eur	Biorb	recombinant
orb81074	Human Dynein Light Chain Roadblock-Type 1 protein DYNLRB1 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 104 amino acids (1-96 a.a.) and having a molec	2	154-Eur	Biorb	elisa
orb81502	Human heat shock 70kDa protein 5 protein Recombinant Human HSPA5 produced in E.coli is a single,non-glycosylated polypeptide chain containing 640 amino acids (20-650 a.a.) and having a molecular mass	5	154-Eur	Biorb	recombinant
orb81503	Human heat shock 70kDa protein 6 protein Recombinant Human HSPA6 produced in E.coli is a single, non-glycosylated polypeptide chain containing 663 amino acids (2-650 a.a.) and having a molecular mass	5	154-Eur	Biorb	recombinant
orb81504	Human Heat Shock 70kDa Protein-8 protein Recombinant Human HSC70 produced in E.coli is a single, non-glycosylated polypeptide chain containing 666 amino acids (1-646 a.a.) and having a molecular mass	2	154-Eur	Biorb	recombinant
orb80030	Human Growth Hormone protein GH Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 192 amino acids and having a molecular mass of 22260.01 Dalton. Growth	20	154-Eur	Biorb	recombinant
orb81505	Human heat shock 70kDa protein 9 protein Recombinant Human HSPA9 produced in E.coli is a single,non-glycosylated polypeptide chain containing 654 amino acids (47-679) and having a molecular mass of 71	10	154-Eur	Biorb	recombinant
orb80342	Human GDF15 D-Vairant protein GDF15 D-variant Human Recombinant produced in E.coli is homodimeric, non-glycosylated, Polypeptide chain containing 2x120 amino acids and having a molecular mass of 26.8	2	154-Eur	Biorb	recombinant
orb80008	Human BMP4 protein BMP4 Human Recombinant produced in E.coli is monomeric, non-glycosylated, Polypeptide chain containing 116 amino acids and having a molecular mass of 13009 Dalton. The BMP-4 is puri	2	154-Eur	Biorb	recombinant
orb81499	E.coli Heat Shock Protein Cofactor 70 (HSP24) protein GrpE Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 197 amino acids and having a molecular mass of 21.8	5	154-Eur	Biorb	recombinant
orb80274	Human BMP2 Monomer protein BMP2 Human Recombinant produced in E.coli is monomeric, non-glycosylated, Polypeptide chain containing 115 amino acids (283-396) and having a molecular mass of 13009 Dalton.	5	154-Eur	Biorb	elisa
orb80172	Human Cyclin-Dependent Kinase Inhibitor 2A protein CDKN2A Human Recombinant produced in E.coli, it's single non-glycosylated polypeptide chain containing 156 amino acids, approximately 16.5 kDa.CDKN2A	10	154-Eur	Biorb	recombinant
SMC-319D	TrpV3 Antibody Monoclonal, Clone number: S15-4 Host: Mouse, Isotype: IgG2a Immunogen: Synthetic peptdie amino acids 458-474 (C-terminus) of rat TrpV3, accession number NP_001020928	100ug	279-Eur	Stressmarq
orb80135	Human GRO-gamma protein GRO-Gamma Human Recombinant produced in E.coli is a single,non-glycosylated, polypeptide chain containing 73 amino acids and having a molecular mass of 7902 Dalton. The CXCL3 i	2	154-Eur	Biorb	recombinant
orb80164	Human TARC protein CCL17 Human Recombinant produced in E.coli is a single,non-glycosylated, polypeptide chain containing 71 amino acids and having a molecular mass of kDa. The TARC is purified by prop	5	154-Eur	Biorb	recombinant
MA1079	Monoclonal Anti-Pan-Cadherin, Clone number: PC-79, Ig type: mouse IgG1, Immunogen: Synthetic peptide corresponding to the C-terminal amino acids of chicken N-Cadherin with an extra N-terminal lysine r	100μg/vial	232-Eur	Bouster Immunoleader
orb80615	Human TGF Beta 3, Plant protein TGFB3 Human Recombinant produced in plant is disulfide-linked homodimeric, glycosylated, polypeptide chain containing 118 amino acids and having a molecular mass of 27.	1	154-Eur	Biorb	recombinant
orb81047	Human Cellular Retinoic Acid binding Protein 2 protein CRABP2 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 136 amino acids and having a molecular mas	5	154-Eur	Biorb	recombinant
SMC-312D	Kir2.3 Antibody Monoclonal, Clone number: S25-35 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 390-445 of human Kir2.3, accession number NP_032453	100ug	279-Eur	Stressmarq
orb81508	Human Heat Shock 27kDa Protein Family, Member 7 protein HSPB7 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 190 amino acids (1-170 a.a.) and having a	2	154-Eur	Biorb	recombinant
SMC-311D	Kir2.2 Antibody Monoclonal, Clone number: S124B-38 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 362-427 of rat Kir2.2, accession number NP_446433	100ug	279-Eur	Stressmarq
orb81116	Human Ferritin Heavy Chain protein FTH1 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 183 amino acids and having a molecular mass of 21 kDa. For resea	5	154-Eur	Biorb	recombinant
SMC-383D	Slo1 Antibody Monoclonal, Clone number: S6-60 Host: Mouse, Isotype: IgG2a Immunogen: Fusion protein amino acids 690-1196 (cytoplasmic C-terminus) of mouse Slo1	100ug	279-Eur	Stressmarq
SMC-309D	KCNQ4 Antibody Monoclonal, Clone number: S43-6 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 2-77 of human KCNQ4, accession number P56696	100ug	279-Eur	Stressmarq
SMC-304D	HCN1 Antibody Monoclonal, Clone number: S70-28 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 778-910 (C terminus) of rat HCN1, accession number Q9JKBO	100ug	279-Eur	Stressmarq
orb82755	Human NAP2 protein Recombinant human CXCL7_NAP2 is a non-glycosylated polypeptide chain containing 70 amino acids. Neutrophil Activating Peptide 2 (NAP2) is proteolytically processed carboxyl-terminal	1 mg	2079-Eur	Biorb	recombinant
orb80540	Human PDGF A protein Platelet-Derived Growth Factor Human Recombinant short chain produced in E.coli is non-glycosylated, polypeptide chain containing 110 amino acids fragment (87-196) and having with	5	154-Eur	Biorb	elisa
orb80141	Human MCP2 protein Monocyte Chemotactic Protein-2 Human Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 76 amino acids and having a molecular mass of 8904 Dalton. The	2	154-Eur	Biorb	recombinant
29-924	SLC17A5 is a membrane transporter that exports free sialic acids that have been cleaved off of cell surface lipids and proteins from lysosomes. Mutations in SLC17A5 gene cause sialic acid storage dise	0.05 mg	632-Eur	Prosci	Proteins
orb80142	Mouse MCP2 protein Monocyte Chemotactic Protein-2 Mouse Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 74 amino acids and having a molecular mass of 8507 Dalton. The	5	154-Eur	Biorb	recombinant
orb80861	Human Peroxisome Proliferator Activated Receptor Gamma (1-477) protein PPARG Human Recombinant encoding amino acids 1-477 expressed in E.coli, is fused to GST tag and it is antibody reactive.The PPARG	2	277-Eur	Biorb	recombinant
orb80269	Human Artemin protein Artemin Human Recombinant produced in E.coli is disulfide-linked homodimer, non-glycosylated, polypeptide chain containing x 113 amino acids and having total molecular mass of 24	5	154-Eur	Biorb	recombinant
AS11 1752	Antibody: AtFH14 | Formin-like protein 14 (100 ug), Immunogen: recombinant formin of Arabidopsis thaliana, amino acids 340-520, NP_17446, Host: mouse, monoclonal, Confirmed reactivity: Arabidopsis tha	100	438-Eur	Gentaur
orb80675	Mouse MCP3 protein Monocyte Chemotactic Protein-3 Mouse Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 74 amino acids and having a molecular mass of 8510 Dalton. The	2	154-Eur	Biorb	recombinant
25-905	SLC27A4 is involved in translocation of long-chain fatty acids (LFCA) across the plasma membrane. It appears to be the principal fatty acid transporter in small intestinal enterocytes. SLC27A4 plays a	0.05 mg	632-Eur	Prosci	assays
orb80690	Human Platelet Factor-4 Variant-1 protein CXCL4 Variant-1 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 77 amino acids and having a molecular mass of	1	154-Eur	Biorb	recombinant
orb80081	Human IL22 protein IL22 Human Recombinant produced in E.coli is a single, non-glycosylated homodimeric polypeptide chain containing x 146 amino acids and having total molecular mass of 33,607 Dalton.	2	154-Eur	Biorb	recombinant
orb80079	Human IL20 protein IL20 Human Recombinant produced in E.coli is a single, non-glycosylated homodimeric polypeptide chain containing x 153 amino acids and having total molecular mass of 35,212 Dalton.	2	154-Eur	Biorb	recombinant
orb80139	Human Lymphotactin (XCL1) protein Lymphotactin Human Recombinant produced in E.coli is a single,non-glycosylated, polypeptide chain containing 92 amino acids and having a molecular mass of 10007 Dalto	5	154-Eur	Biorb	recombinant
orb80370	Zebrafish Growth Hormone Mutant protein Somatotropin Zebrafish Mutant G113R Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 185 amino acids with an additional	100	359-Eur	Biorb	recombinant
orb80542	Human PDGF AB protein Platelet-Derived Growth Factor AB Human Recombinant is heterodimeric, non-glycosylated, polypeptide chain containing 234 amino acids consisting of 13.3kDa alphalpha chain and 12.	2	154-Eur	Biorb	recombinant
orb80143	Human MCP3 protein Monocyte Chemotactic Protein-3 Human Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 76 amino acids and having a molecular mass of 9011 Dalton. The	2	154-Eur	Biorb	recombinant
orb80470	Mouse IL21 protein IL21 Mouse Recombinant produced in E.coli is a single, non-glycosilated polypeptide chain containing 130 amino acids and having total molecular mass of 15kDa. The Murine IL-21 is pu	2	154-Eur	Biorb	recombinant
orb80519	Mouse MCSF protein MCSF Mouse Recombinant produced in E.coli is disulfide linked homodimer, non-glycosylated, polypeptide chain containing x 156 amino acids and having total molecular mass of 36.4 KD.	2	154-Eur	Biorb	recombinant
orb80526	Human Myostatin protein Myostatin Human Recombinant produced in E.coli is homodimer, non-glycosylated polypeptide chain containing x 109 amino acids and having total molecular mass of 24814 Dalton. Th	2	154-Eur	Biorb	recombinant
orb80468	Mouse IL19 protein IL19 Mouse Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 152 amino acids and having a molecular mass of 17722 Dalton. The IL-19 is purifi	2	154-Eur	Biorb	recombinant
orb80445	Mouse IL15 protein IL15 Mouse Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 115 amino acids and having a molecular mass of 13321 Dalton. The IL-15 is purifi	2	154-Eur	Biorb	recombinant
orb80833	Human Mitogen Activated Kinase Kinase 1 protein MAP2K1 active Human Recombinant produced in Sf9 cells is glycosylated, polypeptide chain containing amino acids 2-393 having a molecular mass of 47 kDa.	1	228-Eur	Biorb	recombinant
orb80154	Human MIP4 protein Macrophage Inflammatory Protein-4 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 69 amino acids and having a molecular mass of 7813	2	154-Eur	Biorb	recombinant
orb80242	Human Activin A protein Active form Activin Human Recombinant produced in Plant is a single homodimeric, glycosylated, polypeptide chain containing x 116 amino acids and having molecular weight of 27.	1	154-Eur	Biorb	recombinant
orb82761	Human Otoraplin protein Recombinant Human Otoralpin is a single non-glycosylated polypeptide chain containing 112 amino acids. OTOR, also called Otoraplin and MIAL, is a secreted cytokine and a member	1 mg	2635-Eur	Biorb	recombinant
orb80746	Human Oxytocin protein Oxytocin Human Synthetic is a single, non-glycosylated, polypeptide chain containing amino acids and having a molecular mass of 1007.2144 Dalton.The OT is purified by proprietar	5 mg	154-Eur	Biorb	human
orb80438	Porcine IL10 protein IL10 Porcine Recombinant produced in E.coli is a single, glycosylated polypeptide chain containing 160 amino acids and having a molecular mass of 18458 Dalton. The IL-10 is purifi	2	154-Eur	Biorb	recombinant
orb80088	Human MCSF protein MCSF Human Recombinant produced in E.coli is disulfide linked homodimer, non-glycosylated, polypeptide chain containing x 159 amino acids and having total molecular mass of 36.8 KD.	2	154-Eur	Biorb	recombinant
orb80655	Mouse Eotaxin protein Eotaxin Mouse Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 74 amino acids and having a molecular mass of 8403.2 Dalton. The CCL11 is	5	154-Eur	Biorb	recombinant
orb80144	Human MCP4 protein Monocyte Chemotactic Protein-4 Human Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 74 amino acids and having a molecular mass of 8510 Dalton. The	5	154-Eur	Biorb	recombinant
orb80467	Human IL19 protein IL19 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 155 amino acids and having a molecular mass of 17913 Dalton. The IL-19 is purifi	2	154-Eur	Biorb	recombinant
orb90020	Human Aldose Reductase protein AKR1B1 Human Recombinant amino produced in E.coli is a single, non-glycosylated polypeptide chain containing 316 amino acids having a molecular mass of 35.8 kDa.The AKR1	10	154-Eur	Biorb	recombinant
orb81458	Human Usher Syndrome 1C protein USH1C Human Recombinant fused with 37 amino acid His tag at N-terminus produced in E.coli is a single, non-glycosylated, polypeptide chain containing 570 amino acids (1	5	154-Eur	Biorb	recombinant
orb80695	Human SDF 1 alpha His-Tag protein Stromal Cell-Derived Factor-1 alpha Human Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 78 amino acids, having a molecular mass of	2	154-Eur	Biorb	recombinant
SMC-428D	Brevican Antibody Monoclonal, Clone number: S294A-6 Host: Mouse, Isotype: IgG2B Immunogen: Fusion protein amino acids 219-655 of rat Brevican, accession number P55068	100ug	279-Eur	Stressmarq
orb81515	Human Heat Shock Protein 90 Alpha protein Recombinant Human HSP-90 produced in E.coli is a single,non-glycosylated polypeptide chain containing 732 amino acids and having a molecular mass of 86.8kDa.	10	154-Eur	Biorb	recombinant
orb80868	Human Protein Tyrosine Phosphatase Non Receptor Type-6 protein PTPN6 Human Recombinant produced in E.coli is a single,non-glycosylated polypeptide chain containing 300 amino acids and having a molecul	5	154-Eur	Biorb	recombinant
orb81294	Human RAB5A, Member RAS Oncogene Family protein RAB5A Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 215 amino acids and having a molecular mass of 23k	5	154-Eur	Biorb	recombinant
orb81160	Human Histidine Triad Nucleotide Binding Protein 1 protein HINT1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 126 amino acids (1-126 a.a.) and havin	5	154-Eur	Biorb	recombinant
orb80879	Human Tyr-3_Trp-5 Monooxygenase Activation Protein, Beta protein YWHAB Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 246 amino acids (1-246) and havi	5	154-Eur	Biorb	recombinant
orb81296	Human RAB27A, Member RAS Oncogene Family protein RAB27A Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 241 amino acids (1-221a.a.) and having a molecu	5	154-Eur	Biorb	recombinant
orb90072	Human Deoxyhypusine Synthase protein DHPS Human Recombinant fused to 20 amino acid His Tag at N-terminal produced in E.coli is a single, non-glycosylated, polypeptide chain containing 389 amino acids	5	154-Eur	Biorb	recombinant
orb80076	Human IL15 protein IL15 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 114 amino acids and having a molecular mass of 12774 Dalton. The IL-15 is purifi	2	154-Eur	Biorb	recombinant
orb90056	Human Cysteine Dioxygenase protein CDO1 Human Recombinant fused with 37 amino acid His tag at N-terminus produced in E.coli is a single, non-glycosylated, polypeptide chain containing 207 amino acids	10	154-Eur	Biorb	recombinant
orb80078	Human IL17F protein IL17F Human Recombinant produced in E.coli is homodimeric, cysteine linked, non-glycosylated polypeptide chain containing x 134 amino acids and having total molecular mass of 30.1	5	154-Eur	Biorb	recombinant
orb80463	Human IL18 protein IL18 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 157 amino acids and having a molecular mass of 18302 Dalton. The IL-18 is purifi	5	154-Eur	Biorb	recombinant
orb80558	Human Prolactin protein Prolactin Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 200 amino acids and having a molecular mass of 23007 Dalton. The Prola	10	154-Eur	Biorb	recombinant
orb80956	Human B-Cell Lymphoma Protein Alpha His tag protein Bcl2 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing amino acids 1-211 and having a molecular mass o	5	154-Eur	Biorb	recombinant
orb81295	Human RAB11A, Member RAS Oncogene Family protein RAB11A Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 249 amino acids (1-213a.a.) and having a molecu	5	154-Eur	Biorb	recombinant
orb90054	Human Carbonyl Reductase-3 protein Recombinant Human CBR3 fused with 20 amino acid His tag at N-terminus produced in E.coli is a single, non-glycosylated polypeptide chain containing 297 amino acids (	5	154-Eur	Biorb	recombinant
orb80636	Human VEGF (121) protein VEGF-121 Human Recombinant produced in E.coli is a double, non-glycosylated, polypeptide chain containing 121 amino acids and having a molecular mass of 28423 Dalton. VEGF121	2	154-Eur	Biorb	recombinant
orb80364	Gilthead Seabream Growth Hormone protein Somatotropin Gilthead Seabream Recombinant Sparus Aurata produced in E.coli is a single, non-glycosylated polypeptide chain containing 188 amino acids with an	100	359-Eur	Biorb	recombinant
SMC-404D	Ankyrin G Antibody Monoclonal, Clone number: S106-20 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein 1000 C-terminal amino acids of human Ankyrin G encompassing all of Ankyrin G with the exceptio	100ug	279-Eur	Stressmarq
SMC-343D	TrpC7 Antibody Monoclonal, Clone number: S64A-36 Host: Mouse, Isotype: IgG1 Immunogen: Synthetic peptide amino acids 845-862 of human TRPC7, accession number Q9HCX4	100ug	279-Eur	Stressmarq
orb80177	Human MHC class chain-related gene B protein MICB Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 326 amino acids and having a molecular mass of 37kDa.	10	154-Eur	Biorb	recombinant
SMC-341D	Dnmt3L Antibody Monoclonal, Clone number: S117-9 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 1-387 of human DNMT3L, accession number BAA95556	100ug	279-Eur	Stressmarq
orb80176	Human MHC class chain-related gene A protein MICA Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 320 amino acids and having a molecular mass of 36kDa.	10	154-Eur	Biorb	recombinant
CSB-PA007624GA01HU	Rabbit anti-human ELOVL family member 6, elongation of long chain fatty acids (FEN1_Elo2, SUR4_Elo3-like, yeast) polyclonal Antibody Primary antibody Host:Rabbit IgG	150ul	749-Eur	Cusabio
orb80162	Mouse SDF 1 beta protein Stromal Cell-Derived Factor-1 beta Mouse Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 72 amino acids and having a molecular mass of 8513 Da	2	154-Eur	Biorb	recombinant
orb81046	Human Cellular Retinoic Acid Binding Protein protein CRABP1 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 137 amino acids and having a molecular mass	5	154-Eur	Biorb	recombinant
SMC-413D	GIT1 Antibody Monoclonal, Clone number: S39B-8 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 375-770 (C-terminus) of rat GIT1, accession number Q9Z272	100ug	279-Eur	Stressmarq
EIAAB12844	3-keto acyl-CoA synthase ELOVL5,Elongation of very long chain fatty acids protein 5,ELOVL2,ELOVL5,Fatty acid elongase 1,hELO1,Homo sapiens,Human,PRO0530		1109-Eur	EIAab
orb81500	Human Heat Shock Factor Binding Protein- 1 protein Recombinant Human HSBP1 produced in E.coli is a single,non-glycosylated polypeptide chain containing 76 amino acids and having a molecular mass of 8.	10	154-Eur	Biorb	recombinant
orb80158	Human SDF 1 alpha protein Stromal Cell-Derived Factor-1 alpha Human Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 68 amino acids and having a molecular mass of 8004	2	154-Eur	Biorb	recombinant
orb80005	Human BLyS protein BLyS Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 153 amino acids and having a molecular mass of 17007 Dalton. The BAFF is purifie	5	154-Eur	Biorb	recombinant
orb80159	Mouse SDF 1 alpha protein Stromal Cell-Derived Factor-1 alpha Mouse Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 68 amino acids and having a molecular mass of 7921	2	154-Eur	Biorb	recombinant
CSB-PA007624GA01HU	Rabbit anti-human ELOVL family member 6, elongation of long chain fatty acids (FEN1_Elo2, SUR4_Elo3-like, yeast) polyclonal Antibody Primary antibody Host:Rabbit IgG	50ul	425-Eur	Cusabio
orb80401	Human IGFBP3 protein IGFBP3 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 2x264 amino acids and having a molecular mass of 28806 Dalton. IGFBP-3 is p	5	154-Eur	Biorb	recombinant
SMC-307D	KCNQ1 Antibody Monoclonal, Clone number: S37A-10 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 2-101 of human KCNQ1, accession number P51787	100ug	279-Eur	Stressmarq
SMC-308D	KCNQ2 Antibody Monoclonal, Clone number: S26A-23 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 1-59 of human KCNQ2, accession number O43526	100ug	279-Eur	Stressmarq
AS11 1750	Antibody: AtFH14 | Formin-like protein 14 (50 ug), Immunogen: recombinant formin of Arabidopsis thaliana, amino acids 340-520, NP_17446, Host: mouse, monoclonal, Confirmed reactivity: Arabidopsis thal	50	322-Eur	Gentaur
orb80161	Human SDF 1 beta protein Stromal Cell-Derived Factor-1 beta Human Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 72 amino acids and having a molecular mass of 8508 Da	2	154-Eur	Biorb	recombinant
SMC-382D	Pancortin Antibody Monoclonal, Clone number: S96-7 Host: Mouse, Isotype: IgG1 Immunogen: Synthetic peptide of amino acids 28-48 of human pancortin-1 (SLVGLNTTRLSAASGGTLDRS), accession number Q99784.	100ug	279-Eur	Stressmarq
orb81102	Human FABP5 protein Recombinant Human Epidermal Fatty Acid Binding Protein (FABP-5) is monodimeric, non-glycosylated, polypeptide chain containing 135 amino acids and having total molecular mass of 15	2	154-Eur	Biorb	recombinant
orb80697	Feline SDF 1 beta protein Stromal Cell-Derived Factor-1 beta Feline Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 72 amino acids and having a molecular mass of 8526	2	154-Eur	Biorb	recombinant
orb80827	Human Jun N-terminal kinase 2, alpha 2 protein JNK2 is soluble 51 kDa protein (amino acids 2-424) that is activated in response to cellular stress, radiation and growth factors. JNK2 binds to the amin	2	154-Eur	Biorb	human
MA1085	Monoclonal Anti-PKBα, Clone number: IML-26, Ig type: mouse IgG1, Immunogen: Synthetic peptide corresponding to amino acids 461-477 of human PKBα_Akt1., Specificity: Human;mouse;rat;chicken. No cross r	100μg/vial	232-Eur	Bouster Immunoleader
SMC-302D	CaV1.3 Antibody Monoclonal, Clone number: S38-8 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 2025-2161 of rat Cav1.3, accession number P27732	100ug	279-Eur	Stressmarq
SMC-337D	NR2B Antibody Monoclonal, Clone number: S59-36 Host: Mouse, Isotype: IgG2b Immunogen: Fusion protein amino acids 20-271 (extracellular N-terminus) of rat NR2B, acession number QOO960	100ug	279-Eur	Stressmarq
orb80517	Human MCSF, Baculovirus protein MCSF Human Recombinant produced in E.coli is disulfide linked homodimer, glycosylated, polypeptide chain containing x 149 amino acids and having total molecular mass of	2	154-Eur	Biorb	recombinant
SMC-334D	TrpV3 Antibody Monoclonal, Clone number: S15-39 Host: Mouse, Isotype: IgG2a Immunogen: Synthetic peptide amino acids 458-474 (cytoplasmic C-terminus) of rat TrpV3 accession number NP_001020928)	100ug	279-Eur	Stressmarq
orb80933	Human Alphalpha Synuclein protein alpha Synuclein Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain of 140 amino acids having a molecular mass of 14.4kDa. The Recomb	20	154-Eur	Biorb	recombinant
SMC-386D	GluR2 Antibody Monoclonal, Clone number: S21-32 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 834-883 (cytoplasmic C-terminus) of rat GluR2 accession number P42262.	100ug	279-Eur	Stressmarq
orb80612	Human TGF Beta 2 protein TGFB2 Human Recombinant produced in plants is homodimeric polypeptide chain containing x 118 amino acids and having total molecular mass of 27.8kDa. The TGFB2 is fused to 6xHi	1	154-Eur	Biorb	recombinant
SMC-329D	SHANK1 Antibody Monoclonal, Clone number: S22-21 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 469-691 (SH3_PDZ domains) if rat Shank1 (accession number Q9WV48)	100ug	279-Eur	Stressmarq
29-238	RBPMS is a member of the RRM family of RNA-binding proteins. The RRM domain is between 80-100 amino acids in length and family members contain one to four copies of the domain. The RRM domain consists	0.05 mg	632-Eur	Prosci	rna
25-596	RBPMS is a member of the RRM family of RNA-binding proteins. The RRM domain is between 80-100 amino acids in length and family members contain one to four copies of the domain. The RRM domain consists	0.05 mg	632-Eur	Prosci	rna
25-305	The PR domain is a protein-protein interaction module of about 100 amino acids. PR domain-containing proteins, such as PRDM9, are often involved in transcriptional regulation.The PR domain is a protei	0.05 mg	632-Eur	Prosci	Proteins
29-239	RBPMS is a member of the RRM family of RNA-binding proteins. The RRM domain is between 80-100 amino acids in length and family members contain one to four copies of the domain. The RRM domain consists	0.1 mg	496-Eur	Prosci	rna
bs-1331P	Peptides: sFRP-4(Secreted frizzled-related protein 4; Frizzled protein, human endometrium) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
orb81552	Chlamydia Trachomatis HSP70 (462-503) protein The E.coli derived recombinant protein contains Chlamydia TrachomatisHSP70 protein epitopes, 462-503 amino acids. For research use only.	100	228-Eur	Biorb	recombinant
orb81738	HIV-2 gp36 (390-702) protein HIV-2 gp36 34 kDa recombinant- contains the sequence of HIV-2 envelope immunodominant regions gp36, amino acids 390-702. The protein is fused to beta-galactosidase (114 kD	100	228-Eur	Biorb	recombinant
orb81553	Chlamydia Trachomatis HSP70 (549-660) protein The E.coli derived recombinant protein contains Chlamydia TrachomatisHSP70 protein epitopes, 549-660 amino acids. For research use only.	100	228-Eur	Biorb	recombinant
orb81384	Staphylococcal Protein 434 a.a protein Recombinant Staphylococcal Protein produced in E.coli is non-glycosylated, Polypeptide chain containing 434 amino acids (37-469 a.a.) and having a molecular mass	10	154-Eur	Biorb	recombinant
orb81528	Malaria Cs Mosaic protein The E.coli derived recombinant protein contains the Plasmodium Falciparum Cs Mosaic protein epitopes 107-129, 334-351amino acids. For research use only.	100	228-Eur	Biorb	recombinant
orb82758	Human Oncostatin M (209) protein Recombinant Human Oncostatin M (209 aa) is a single non-glycosylated polypeptide chain containing 209 amino acids. Oncostatin M (OSM) is a growth and differentiation f	1 mg	2799-Eur	Biorb	recombinant
orb81711	HIV-1 gp120 nef Mosaic protein HIV-1 gp120 is non-glycosylated polypeptide chain, containing HIV-1 gp120 N-terminus immunodominant regions, 30-110 amino acids. The protein is fused to six histidines t	100	228-Eur	Biorb
orb81473	Human Visinin-Like Protein-1 His Tag protein Visinin-Like Protein-1 Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 201 amino acids and having a molecular ma	2	154-Eur	Biorb	recombinant
orb80643	Human VEGF Related protein VEGF-C Human Recombinant- contains 129 amino acids residues and was fused to His- tag (6x His) at the C-terminal end. As result of glycosylation VEGF-C migrates as an 18-24	2	154-Eur	Biorb	recombinant
orb80784	C-JUN protein C-JUN amino acids 1-81 produced in E.coli, is non-glycosylated, polypeptide chain having a molecular mass of 52 kDa.C-JUN is maltose binding protein (MBP) fusion protein with an amino-te	2	154-Eur	Biorb	recombinant
orb80698	Human TARC His Tag protein TARC Human Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 92 amino acids (24-94 a.a.) and having a molecular mass of 10.3 kDa. The TARC is	2	154-Eur	Biorb	recombinant
orb80858	Human Protein Kinase q protein PKC-q Human Recombinant produced in Sf9 is glycosylated, polypeptide chain containing amino acids 2-706 and having a molecular mass of 86 KD. This protein is the full-le	2	154-Eur	Biorb	recombinant
orb80857	Human Protein Kinase gamma protein PKC-g Human Recombinant produced in Sf9 is glycosylated, polypeptide chain containing amino acids 2-676 and having a molecular mass of 80 KD. This protein is the ful	2	154-Eur	Biorb	recombinant
orb80855	Human Protein Kinase delta protein PKC-d Human Recombinant produced in Sf9 is glycosylated, polypeptide chain containing amino acids 2-676 and having a molecular mass of 80 KD. This protein is the ful	2	154-Eur	Biorb	recombinant
orb81536	SARS Associated Coronavirus Matrix protein The E.coli derived 30kDa recombinant protein contains the Matrix protein 182-216 amino acids immunodominant regions. For research use only.	100	228-Eur	Biorb	recombinant
orb80854	Human Protein Kinase beta 2 protein PKC-bII Human Recombinant produced in Sf9 is glycosylated, polypeptide chain containing amino acids 2-673 and having a molecular mass of 80 KD. This protein is the	2	154-Eur	Biorb	recombinant
orb80853	Human Protein Kinase beta 1 protein PKC-bI Human Recombinant produced in Sf9 is glycosylated, polypeptide chain containing amino acids 2-671 and having a molecular mass of 80 KD. This protein is the f	2	154-Eur	Biorb	recombinant
orb81519	E.coli Chaperone Protein SKP protein SKP Recombinant E.coli produced in E.coli is a single, non-glycosylated polypeptide chain containing 162 amino acids (21-161 a.a.) and having a molecular mass of 1	5	154-Eur	Biorb	recombinant
bs-0796P	Peptides: FSCN1 (Fascin 1 protein; fascin homolog 1, actin-bundling protein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
28-042	PDLIM5 is a LIM domain protein. LIM domains are cysteine-rich double zinc fingers composed of 50 to 60 amino acids that are involved in protein-protein interactions. LIM domain-containing proteins are	0.1 mg	496-Eur	Prosci	Proteins
orb80560	Mouse Prolactin protein Prolactin Mouse Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 198 amino acids and having a molecular mass of 22.5 kDa. The Prolactin	10	154-Eur	Biorb	recombinant
orb80562	Ovine Prolactin protein Prolactin Ovine Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 199 amino acids and having a molecular mass of 23 kDa. The Prolactin i	10	154-Eur	Biorb	recombinant
orb80632	Human VEGF His Tag protein VEGF Human Recombinant produced in E.coli is non-glycosylated, polypeptide chain containing 165 amino acids fragment (5-169) and having a molecular mass of 23.6 kDa.The VEGF	2	154-Eur	Biorb	recombinant
orb80495	Porcine Leptin protein Leptin Porcine Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 146 amino acids and having a molecular mass of 16 kDa.The Leptin is pur	100	359-Eur	Biorb	recombinant
28-945	PDLIM5 is a LIM domain protein. LIM domains are cysteine-rich double zinc fingers composed of 50 to 60 amino acids that are involved in protein-protein interactions. LIM domain-containing proteins are	0.1 mg	496-Eur	Prosci	Proteins
orb81742	HTLV-1 p24 Core protein The E.coli derived recombinant protein contains the full-length sequence of HTLV-I p24, spanning all of p24.The protein contains 214 amino acids having an Mw of 24kDa. For rese	100	228-Eur	Biorb	recombinant
30-357	HADHB is the beta subunit of the mitochondrial trifunctional protein, which catalyzes the last three steps of mitochondrial beta-oxidation of long chain fatty acids. The mitochondrial membrane-bound h	0.05 mg	632-Eur	Prosci	cat
orb60021	Salmon Calcitonin Salmon Calcitonin(Miacalcin, Fortical) is a synthetic polypeptide of 32 amino acids in the same linear sequence that is found in clacitonin of salmon origin. For research use only.	50 mg	360-Eur	Biorb
orb81302	Human RAD1 protein RAD1 Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 301 amino acids (1-282 a.a.) and having a molecular mass of 33.9 kDa. The RAD1 i	2	154-Eur	Biorb	recombinant
orb80499	Chicken Leptin protein Leptin Chicken Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 145 amino acids and having a molecular mass of 16 kDa.The Leptin is pur	100	359-Eur	Biorb	recombinant
orb80465	Mouse IL18 protein IL18 Mouse Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 178 amino acids (36-192 a.a.) and having a molecular mass of 20.4 kDa. The Mouse	5	154-Eur	Biorb	recombinant
orb80856	Human Protein Kinase e protein PRKCE Human Recombinant produced in Sf9 is glycosylated, polypeptide chain containing amino acids 2-737 and having a molecular mass of 87 KD. This protein is the full-le	2	154-Eur	Biorb	recombinant
orb80631	Human Vaspin protein Vaspin Human Recombinant produced in E.coli is a single, non-glycosylated, His Tag, polypeptide chain containing 415 amino acids and having a molecular mass of 47 kDa.The Vaspin i	5	154-Eur	Biorb	recombinant
orb81550	Chlamydia Trachomatis W3-W6 protein The E.coli derived recombinant 6xHis fusion at C-terminus. protein contains Chlamydia TrachomatisMOMP protein epitopes, 128-398 amino acids. For research use only.	100	228-Eur	Biorb	recombinant
25-451	PDLIM5 is a LIM domain protein. LIM domains are cysteine-rich double zinc fingers composed of 50 to 60 amino acids that are involved in protein-protein interactions. LIM domain-containing proteins are	0.05 mg	632-Eur	Prosci	Proteins
orb81142	Yeast GLC8 protein GLC8 Recombinant produced in Yeast is a single, glycosylated polypeptide chain containing 265 amino acids (1-229) and having a molecular mass of 30.7 kDa. The GLC8 is fused to 35 am	10	154-Eur	Biorb	recombinant
orb80781	Human c-erbB2 protein c-erbB2 Human Recombinant encoding 537-636 amino acids expressed in E.colic-erbB2 is purified by proprietary chromatographic techniques. For research use only.	2	277-Eur	Biorb	recombinant
orb80453	Human IL17E protein IL17E Human Recombinant produced in E.coli is homodimeric, non-glycosylated polypeptide chain containing 146 amino acids and having a molecular mass of 33.7 kDa. The IL-25 Human is	5	154-Eur	Biorb	recombinant
orb80018	Human Epiregulin protein Epiregulin Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 50 amino acids and having a molecular mass of kDa. Epiregulin is pu	5	154-Eur	Biorb	recombinant
orb90275	E.coli Chaperone SURA protein SURA E.coli Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 429 amino acids (21-428 a.a.) and having molecular wieght of 47.3 kD	5	154-Eur	Biorb	recombinant
orb80341	Human GDF15 protein Recombinant Human GDF15 produced in E.coli is a single, non-glycosylated polypeptide chain containing 151 amino acids (195-308) and having a molecular mass of 16.7 kDa.GDF15 is exp	2	154-Eur	Biorb	recombinant
orb90284	Human Tumor Protein p53 Inducible Protein 3 protein TP53I3 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 352 amino acids (1-332 a.a.) and having a mo	5	154-Eur	Biorb	recombinant
orb80016	Human EMAP II protein EMAP-II Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 166 amino acids and having a molecular mass of 18.3 kDa. The EMAP-II is pu	5	154-Eur	Biorb	recombinant
orb80379	Human HGF CHO protein HGF Human Recombinant produced in CHO is heterodimer, non-glycosylated, polypeptide chain consisting an alpha chain of 463 amino acids and b-chain of 234 having total molecular m	2	154-Eur	Biorb	recombinant
AS11 1627	Antibody: RBR1 | retinoblastoma related protein, Immunogen: recombinant C-terminal fragment consisting of 236 amino acids of Arabidopsis thaliana retinoblastoma protein Q9LKZ3, locus At3g12280, Host:	50	337-Eur	Gentaur
SMC-438D	AMIGO-1 Antibody Monoclonal, Clone number: S86-36 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 554-574 (cytoplasmic C-terminus) of human AMIGO-1, accession number Q86WK6	100ug	279-Eur	Stressmarq
SMC-342D	Nav1.8 Antibody Monoclonal, Clone number: S134-12 Host: Mouse, Isotype: IgG2a Immunogen: Fusion protein amino acids 1724-1956 of rat Nav1.8, accession number Q62968	100ug	279-Eur	Stressmarq
AS10 1603	Antibody: HliA | high light inducible protein (300 ul), Immunogen: synthetic peptide (amino acids 1 – 17) specific for HliA protein from Synechocystis sp. PCC 6803, NP_440529.1, Host: rabbit, po	300 ul	871-Eur	Gentaur
SMC-320D	HCN4 Antibody Monoclonal, Clone number: S114-10 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 1-019-1198 (c-terminus) of rat HCN4, accession number Q9JKA7	100ug	279-Eur	Stressmarq
SMC-423D	Synaptotagmin-10 Antibody Monoclonal, Clone number: S269-73 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 248-335 (Cytoplasmic C2A domain) of mouse Synaptotagmin-10, accession numbe	100ug	279-Eur	Stressmarq
AS10 1616	Antibody: HliA | high light inducible protein (100 ul), Immunogen: synthetic peptide (amino acids 1 – 17) specific for HliA protein from Synechocystis sp. PCC 6803, NP_440529.1, Host: rabbit, po	100 ul	381-Eur	Gentaur
SMC-430D	Notch1 Antibody Monoclonal, Clone number: S253-32 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 20-216(extracellular N-terminus, EGF-like domains 1-5) of mouse Notch1, accession num	100ug	279-Eur	Stressmarq
AS10 1610	Antibody: HliD | High light inducible protein (100 ul), Immunogen: synthetic peptide (amino acids 15 – 30) for HliD protein from Synechocystis sp. PCC 6803. NP_440269.1, Host: rabbit, polyclonal	100 ul	381-Eur	Gentaur
orb81414	Human Tissue Factor Pathway Inhibitor 2 protein TFPI2 Human Recombinant produced in plants is a single polypeptide chain containing 79 amino acids and having total molecular mass of 9.3kDa. The TFPI2	2	277-Eur	Biorb	recombinant
SMC-399D	Copper Transporting ATPase2 Antibody Monoclonal, Clone number: S62-29 Host: Mouse, Isotype: IgG1 Immunogen: Synthetic peptide amino acids 3-21 (cytoplasmic N-terminus) of human Copper-transporting ATP	100ug	279-Eur	Stressmarq
SMC-405D	CaV3.1 Antibody Monoclonal, Clone number: S178A-9 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 2052-2172 (cytoplasmic C-temrinus) of mouse Cav3.1	100ug	279-Eur	Stressmarq
SMC-398D	Copper Transporting ATPase1 Antibody Monoclonal, Clone number: S60-4 Host: Mouse, Isotype: IgG2b Immunogen: Synthetic peptide amino acids 42-61 (cytoplasmic C-terminus) of human Copper- transporting A	100ug	279-Eur	Stressmarq
NU-829-THIO12	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - ATTO-Thio12	80	746-Eur	Jena Bio
NU-829-RHO13	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - ATTO-Rho13	80	746-Eur	Jena Bio
NU-807-RHO14	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - ATTO-Rho14	80	746-Eur	Jena Bio
NU-807-RHO6G	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - ATTO-Rho6G	80	746-Eur	Jena Bio
NU-829-RHO14	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - ATTO-Rho14	80	746-Eur	Jena Bio
NU-807-THIO12	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - ATTO-Thio12	80	746-Eur	Jena Bio
NU-803-FAMX	Nucleic acids: Fluorescein-12-dUTP Fluorescein-X-5-Aminoallyl-dUTP	30	209-Eur	Jena Bio
NU-830-RHO13	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - ATTO-Rho13	80	746-Eur	Jena Bio
NU-803-BIO	Nucleic acids: Biotin-4-dUTP, pack Biotin-5-Aminoallyl-dUTP	200	235-Eur	Jena Bio
NU-829-RHO6G	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - ATTO-Rho6G	80	746-Eur	Jena Bio
NU-807-RHO101	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - ATTO-Rho101	80	746-Eur	Jena Bio
NU-829-RHO11	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - ATTO-Rho11	80	746-Eur	Jena Bio
NU-829-RHO101	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - ATTO-Rho101	80	746-Eur	Jena Bio
NU-807-612Q	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - ATTO-612Q	80	746-Eur	Jena Bio
NU-807-580Q	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - ATTO-580Q	80	746-Eur	Jena Bio
NU-807-540Q	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - ATTO-540Q	80	746-Eur	Jena Bio
NU-807-RHO13	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - ATTO-Rho13	80	746-Eur	Jena Bio
NU-807-RHO11	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - ATTO-Rho11	80	746-Eur	Jena Bio
NU-829-540Q	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - ATTO-540Q	80	746-Eur	Jena Bio
NU-829-580Q	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - ATTO-580Q	80	746-Eur	Jena Bio
NU-829-612Q	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - ATTO-612Q	80	746-Eur	Jena Bio
NU-807-647N	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - ATTO-647N	20	209-Eur	Jena Bio
NU-829-647N	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - ATTO-647N	80	746-Eur	Jena Bio
NU-807-RHO12	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - ATTO-Rho12	80	746-Eur	Jena Bio
NU-829-RHO12	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - ATTO-Rho12	80	746-Eur	Jena Bio
NU-830-RHO6G	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - ATTO-Rho6G	80	746-Eur	Jena Bio
NU-830-RHO14	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - ATTO-Rho14	80	746-Eur	Jena Bio
NU-809-FAMX	Nucleic acids: Fluorescein-12-dCTP Fluorescein-X-5-Propargylamino-dCTP	30	209-Eur	Jena Bio
NU-830-RHO12	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - ATTO-Rho12	80	746-Eur	Jena Bio
NU-830-RHO11	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - ATTO-Rho11	80	746-Eur	Jena Bio
NU-830-THIO12	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - ATTO-Thio12	80	746-Eur	Jena Bio
NU-832-485XL	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - DY-485XL	80	746-Eur	Jena Bio
NU-830-RHO101	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - ATTO-Rho101	80	746-Eur	Jena Bio
NU-832-480XL	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cGMP - DY-480XL	160	746-Eur	Jena Bio
NU-830-612Q	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - ATTO-612Q	80	746-Eur	Jena Bio
NU-809-BIO	Nucleic acids: Biotin-4-dCTP, pack Biotin-5-Propargylamino-dCTP	200	235-Eur	Jena Bio
NU-851-480XL	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - DY-480XL	80	746-Eur	Jena Bio
NU-851-485XL	Nucleic acids: 8-[(6-Amino)hexyl]-amino-cAMP - DY-485XL	80	746-Eur	Jena Bio
NU-830-647N	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - ATTO-647N	80	746-Eur	Jena Bio
NU-830-540Q	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - ATTO-540Q	800	746-Eur	Jena Bio
NU-830-580Q	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - ATTO-580Q	80	746-Eur	Jena Bio
orb80639	Mouse VEGF-Sf9 protein VEGF Mouse Recombinant produced in Sf9 insect cells is a double, glycosylated, polypeptide chain containing 164 amino acids and having a molecular mass of 48 kDa.The VEGF is pur	2	154-Eur	Biorb	recombinant
orb81017	Human CD163 protein CD163 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 805 amino acids and having a molecular mass of 87 kDa. The CD163 is purified	10	154-Eur	Biorb	recombinant
orb80119	Human CCL16 protein CCL16 Human Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 97 amino acids and having a molecular mass of 11.2 kDa. The CCL16 is purified by propri	5	154-Eur	Biorb	recombinant
orb80083	Human IL33 protein Human IL33 Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 160 amino acids and having a molecular mass of 18 kDa. The IL33 is purified by	2	154-Eur	Biorb	recombinant
orb82655	Exendin 4 protein Recombinant Exendin-4 is single non-glycosylated polypeptide chain containing 39 amino acids. Exendin-4 is a novel 39-amino acid peptide isolated from the venom of the Gila monster H	1 mg	473-Eur	Biorb	recombinant
orb81612	Hepatitis Virus NS5 Genotype-2b protein The E.coli derived recombinant protein contains the HCV NS5 Genotype 2a immunodominant regions, amino acids 2212-2313. The protein is fused to GST tag at N-Term	100	228-Eur	Biorb	recombinant
25-717	Albumin is a soluble, monomeric protein which comprises about one-half of the blood serum protein. Albumin functions primarily as a carrier protein for steroids, fatty acids, and thyroid hormones and	0.05 mg	632-Eur	Prosci
25-718	Albumin is a soluble, monomeric protein which comprises about one-half of the blood serum protein. Albumin functions primarily as a carrier protein for steroids, fatty acids, and thyroid hormones and	0.05 mg	632-Eur	Prosci
orb80716	Human Gastrin protein Gastrin Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 102 amino acids and having total Mw of 38kDa. Gastrin is fused to GST tag	2	277-Eur	Biorb	recombinant
orb90307	E.coli Uridine phosphorylase protein UPP1 E.coli Recombinant protein produced in E.coli is a single, non-glycosylated, polypeptide chain containing 273 amino acids (1-253) and having a molecular mass	5	154-Eur	Biorb	recombinant
orb80492	Ovine Leptin protein Leptin Ovine Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 146 amino acids and having a molecular mass of 16 kDa.The Leptin is purifie	100	359-Eur	Biorb	recombinant
orb82735	Human KGF protein Recombinant human FGF10 is a single, non-glycosylated polypeptide chain containing 170 amino acids consisting of Methionine and the mature human KGF-2 (amino acid residues 40 - 208).	1 mg	2799-Eur	Biorb	recombinant
orb80485	Human Leptin protein Leptin Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 146 amino acids and having a molecular mass of 16 kDa.The Leptin is purifie	200	154-Eur	Biorb	recombinant
orb80501	Rabbit Leptin protein Leptin Rabbit Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 146 amino acids and having a molecular mass of 16 kDa.The Leptin is purif	100	359-Eur	Biorb	recombinant
orb80380	Human HGF Sf9 protein HGF Human Recombinant produced in Baculovirus is heterodimer, non-glycosylated, polypeptide chain consisting an alphalpha chain of 463 amino acids and betalpha chain of 234 havin	2	154-Eur	Biorb	recombinant
orb80541	Mouse PDGF AA protein PDGF-AA Mouse Recombinant is disulfide linked homodimeric, non-glycosylated, polypeptide chain containing x 126 amino acids and having total molecular mass of 28.9 kDa. PDGF-AA i	2	154-Eur	Biorb	recombinant
orb80548	Human PEDF HEK protein PEDF Human Recombinant produced in HEK cells is a single, glycosylated, polypeptide chain containing 410 amino acids and having a molecular mass of 45.6 kDa. The Human Sentrin-F	2	154-Eur	Biorb	recombinant
orb80451	Mouse IL16 protein IL16 Mouse Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 127 amino acids and having a molecular mass of 13.2 kDa. The Mouse IL-16 is puri	2	154-Eur	Biorb	recombinant
orb80017	Human Epigen protein Epigen Recombinant Human produced in E.coli is a single, non-glycosylated, polypeptide chain containing 72 amino acids and having a molecular mass of 7.9 kDa. Epigen is purified b	5	154-Eur	Biorb	recombinant
orb81099	Human FABP3 His tag protein FABP3 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 133 amino acids and having a molecular mass of 19.1 kDa. FABP3 is fuse	5	154-Eur	Biorb	recombinant
orb80456	Mouse IL17E protein IL17E Mouse Recombinant produced in E.coli is homodimeric, non-glycosylated polypeptide chain containing total of 306 amino acids and having a molecular mass of 34.9 kDa. The Mouse	5	154-Eur	Biorb	recombinant
orb80494	Bovine Leptin protein Leptin Bovine Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 146 amino acids and having a molecular mass of 16 kDa.The Leptin is purif	100	359-Eur	Biorb	recombinant
orb80457	Mouse IL17F protein IL17F Mouse Recombinant produced in E.coli is homodimeric, non-glycosylated polypeptide chain containing total of 266 amino acids and having a molecular mass of 29.8 kDa. The Mouse	5	154-Eur	Biorb	recombinant
orb81101	Human FABP4 His tag protein FABP4 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 132 amino acids and having a molecular mass of 18 kDa. FABP4 is fused	5	154-Eur	Biorb	recombinant
orb81105	Human FABP6 His tag protein FABP6 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 128 amino acids and having a molecular mass of 18 kDa. FABP6 is fused	5	154-Eur	Biorb	recombinant
orb80377	Human GMF Gamma protein GMF-Gamma (GMF-Gamma) Human Recombinant produced in E.coli is signle, non-glycosylated, polypeptide chain containing 142 amino acids and having total molecular mass of 16.8 kDa	5	154-Eur	Biorb	recombinant
orb80290	Human CTGF protein CTGF Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 98 amino acids and having a molecular mass of 11.2 kDa. The CTGF is purified by	5	154-Eur	Biorb	recombinant
orb81197	Human LIN28 protein Recombinant Human LIN28 produced in E.coli is a single, non-glycosylated polypeptide chain containing 191 amino acids (42-209) and having a molecular mass of 21.1 kDa.LIN28 is expr	2	154-Eur	Biorb	recombinant
orb81028	Human Chromogranin GST Tag protein Chromogranin Human Recombinant (260-454 amino acids) expressed in E.coli, shows 47kDa band on SDS-PAGE. The Chromogranin is fused to 26kDa GST-tag and purified by pr	2	277-Eur	Biorb	recombinant
orb81223	Human MutS Homolog 6 protein MSH6 Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 51 amino acids (350-400 a.a.) having total Mw of 33 kDa. Human MSH6 i	2	277-Eur	Biorb	recombinant
orb90162	Human Latexin protein Recombinant Human Latexin produced in E.coli is a single, non-glycosylated polypeptide chain containing 222 amino acids and having a molecular mass of 19.4 kDa. Latexin is purifi	5	154-Eur	Biorb	recombinant
orb80498	Horse Leptin protein Leptin Horse Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 146 amino acids and having a molecular mass of 16 kDa.The Leptin is purifie	100	359-Eur	Biorb	recombinant
orb80488	Mouse Leptin protein Leptin Mouse Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 147 amino acids and having a molecular mass of 16.2 kDa.The Leptin is purif	200	154-Eur	Biorb	recombinant
orb81506	Human Heat Shock Protein-Binding Protein 1 protein HSPBP1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 382 amino acids (1-362 a.a.) and having a mol	2	154-Eur	Biorb	recombinant
orb80653	Human CTACK protein CTACK Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 89 amino acids (25-112 a.a.) and having a molecular mass of 10.3kDa. CTACK pr	5	154-Eur	Biorb	recombinant
orb80036	Human GMF Beta protein GMF-Beta (GMF-Beta) Human Recombinant produced in E.coli is signle, non-glycosylated, polypeptide chain containing 141 amino acids and having total molecular mass of 16.5 kDa. G	2	154-Eur	Biorb	recombinant
orb81424	Human Tumor Protein D52 L1 protein TPD52L1 Human Recombinant His-Tag fusion protein produced in E.coli is a single, non-glycosylated polypeptide chain containing amino acids 151 and having a molecular	5	154-Eur	Biorb	recombinant
orb81619	Hepatitis Virus NS5 Genotype-6a protein The E.coli derived recombinant protein contains the HCV NS5 Genotype 6a immunodominant regions, amino acids 2212-2313. The protein is fused with GST tag N-termi	100	228-Eur	Biorb	recombinant
orb81616	Hepatitis Virus NS5 Genotype-4 protein The E.coli derived recombinant protein contains the HCV NS5 Genotype immunodominant regions, amino acids 2212-2313. The protein is fused with GST tag at N-termin	100	228-Eur	Biorb	recombinant
orb81254	Human Polyadenylate-Binding Protein-Interacting Protein 2 protein Recombinant Human PAIP2 produced in E.coli is a single,non-glycosylated polypeptide chain containing 147 amino acids (1-127 a.a.) and	5	154-Eur	Biorb	recombinant
orb81611	Hepatitis Virus NS5 Genotype-2a protein The E.coli derived recombinant protein contains the HCV NS5 Genotype 2a immunodominant regions, amino acids 2212-2313. The protein is fused to GST tag at N-term	100	228-Eur	Biorb	recombinant
orb82770	Human SOD protein Recombinant Human Superoxide Dimutase is a homodimer, non-glycosylated polypeptide chain containing 2 x 154 amino acids. Human Cu_Zn Superoxide Dismutase (SOD) catalyzes the reaction	1 mg	653-Eur	Biorb	recombinant
orb81615	Hepatitis Virus NS5 Genotype-3b protein The E.coli derived recombinant protein contains the HCV NS5 Genotype 3b immunodominant regions, amino acids 2212-2313. The protein is fused to GST-tag at N-term	100	228-Eur	Biorb	recombinant
orb81614	Hepatitis Virus NS5 Genotype-3a protein The E.coli derived recombinant protein contains the HCV NS5 Genotype 3a immunodominant regions, amino acids 2212-2313. The protein is fused to GST tag at N-term	100	228-Eur	Biorb	recombinant
orb81603	Hepatitis Virus NS4 a+b, Fluorescein Labeled protein The E.coli derived 19 kDa recombinant protein Fluoroscien labeled contains the HCV NS4 immunodominant regions, amino acids 1658-1863. The protein i	100	359-Eur	Biorb	recombinant
orb80068	Mouse IL10 protein IL-10 Recombinant Mouse produced in E.coli is a single, non-glycosylated polypeptide chain containing 161 amino acids and having a molecular mass of 18785 Dalton. The IL10 Mouse is	2	154-Eur	Biorb	recombinant
orb80071	Mouse IL11 protein IL11 Mouse Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 179 amino acids and having a molecular mass of 19.2kDa. The Mouse IL-11 is purif	2	154-Eur	Biorb	recombinant
orb80651	Human BRAK protein CXCL14 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 88 amino acids and having a molecular mass of 10.66 kDa. The Human BRAK conta	5	154-Eur	Biorb	recombinant
orb80337	Human GDF3 protein GDF3 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 124 amino acids and having total molecular mass of 14.15 kDa.GDF3 is fused to 1	5	154-Eur	Biorb	recombinant
orb80726	Human Glucagon protein Glucagon Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 29 amino acids and having a molecular mass of 3483 Dalton. The Glucagon	100	154-Eur	Biorb	recombinant
orb80297	Mouse EBI3 protein EBI3 Mouse Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 207 amino acids and having a molecular mass of 23 kDa. The Murine EBI3 is purifi	2	154-Eur	Biorb	recombinant
orb81107	Human FABP7 His tag protein FABP7 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 132 amino acids and having a molecular mass of 19.39kDa. FABP7 is fuse	5	154-Eur	Biorb	recombinant
25-764	FADS1 is a member of the fatty acid desaturase (FADS) family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl	0.05 mg	632-Eur	Prosci	rat
29-745	FADS1 is a member of the fatty acid desaturase (FADS) family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl	0.1 mg	496-Eur	Prosci	rat
orb80298	Human EG VEGF protein EG-VEGF Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 86 amino acids and having a molecular mass of 9605 Dalton.The EG-VEGF is	5	154-Eur	Biorb	elisa
orb80120	Mouse CXCL16 protein CXCL16 Mouse Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 88 amino acids and having a molecular mass of 9.9kDa. The CXCL16 is purifie	5	154-Eur	Biorb	recombinant
orb80282	Mouse beta NGF protein NGF beta Mouse produced in Submaxillary Gland of Grown Mouse is homodimer, non-glycosylated, polypeptide chain containing identical 120 amino acids and having a molecular mass o	5	154-Eur	Biorb	human
orb81496	Human GroEL (HSP60) protein Recombinant GroEL, HSP60 produced in E.coli is a single, non-glycosylated polypeptide chain containing 593 amino acids and having a molecular mass of 63kDa.The HSP60 is fus	5	154-Eur	Biorb	recombinant
orb81097	Human FABP2 protein FABP2 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 132 amino acids and having a molecular mass of 17.3kDa. FABP2 is fused to 20 a	5	154-Eur	Biorb	recombinant
orb80634	Human VEGF HEK protein VEGF Human Recombinant produced in HEK293 cells is a double, glycosylated, polypeptide chain containing 165 amino acids and having a molecular mass of 40 kDa. The VEGF is purifi	2	154-Eur	Biorb	recombinant
orb81103	Human FABP5 His tag protein FABP5 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 135 amino acids and having a molecular mass of 19.66kDa. FABP5 is fuse	5	154-Eur	Biorb	recombinant
orb80146	Mouse MDC protein CCL22 Mouse Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 68 amino acids and having a molecular mass of 7.8kDa. The Mouse CCL22 is purified by prop	5	154-Eur	Biorb	recombinant
orb82774	Human Syndecan 4 protein Recombinant human Syndecan is a single non-glycosylated polypeptide chain containing 140 amino acids. Syndecan-4 is a type I integral membrane heparan sulfate proteoglycan (HS	1 mg	1980-Eur	Biorb	recombinant
orb80165	Human TECK protein TECK Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 127 amino acids and having a molecular mass of 14.2kDa. The TECK is purified by	5	154-Eur	Biorb	recombinant
orb80157	Human Rantes protein Rantes Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 68 amino acids and having a molecular mass of 7809.2 Dalton. The Rantes is p	5	154-Eur	Biorb	recombinant
orb90157	Human Kallikrein-1 protein KLK1 Human Recombinant produced in Yeast is a single, glycosylated, polypeptide chain containing 238 amino acids and having a molecular mass of 28-32 kDa.KLK1 Human Recombin	20	154-Eur	Biorb	recombinant
orb80400	Human IGFBP1 protein IGFBP1 native Human is a single, glycosylated, polypeptide chain containing 218 amino acids and having a molecular mass of 25.3kDa. IGFBP1 is purified by proprietary chromatograph	2	277-Eur	Biorb	human
orb80589	Mouse RELM beta protein Mouse RETNLB Recombinant produced in E.coli is monomeric, non-glycosylated, polypeptide chain containing 83 amino acids and having a molecular mass of 8.8 kDa. The Mouse RETNLB	5	154-Eur	Biorb	recombinant
AS08 287	Antibody: HSP101 | ClpB heat shock protein, C-terminal, Immunogen: recombinant protein of Arabidopsis thaliana Hsp101_ClpB, C-terminal 145 amino acids P42730, Host: rabbit, polyclonal, Confirmed react	200	337-Eur	Gentaur
SMC-376D	Nav1.1 Antibody Monoclonal, Clone number: S74-71 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 1929-2009 (cytoplamsic Cterminus) of rat Nav1.1, accession number P04774.	100ug	279-Eur	Stressmarq
SMC-314D	Nav1.7 Antibody Monoclonal, Clone number: S68-6 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 1751-1946 (C-terminus) of human Nav1.7, accession number Q15858	100ug	279-Eur	Stressmarq
AS10 1615	Antibody: HliD | High light inducible protein (300 ul), Immunogen: synthetic peptide (amino acids 15 – 30) derived from Synechocystis sp. PCC 6803 HliD protein NP_440269.1, Host: rabbit, polyclo	300 ul	871-Eur	Gentaur
SMC-303D	CaV3.2 Antibody Monoclonal, Clone number: S55-10 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 1019-1293 (II-III loop) of human Cav3.2, accession number O95180	100ug	279-Eur	Stressmarq
SMC-347D	Thorase_Atad1 Antibody Monoclonal, Clone number: S125-10 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 1-361 (Full length) of mouse Thorase, accession number Q9D5TO`	100ug	279-Eur	Stressmarq
orb80103	Mouse IL25 protein IL25 Mouse Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 143 amino acids and having a molecular mass of 15.8kDa. The Mouse SF20 is purif	2	154-Eur	Biorb	recombinant
AS10 1611	Antibody: STN7 | serine_threonine-protein kinase STN7, chloroplastic , Immunogen: KLH-conjugated synthetic peptide (amino acids 128 – 141) specific for Arabidopsis thaliana STN7 serine_threonine	100 ug - for reconstitution please add 100 ul of sterile water	361-Eur	Gentaur
orb80402	Human IGFBP5 protein IGFBP5 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 253 amino acids and having a molecular mass of 28613 Dalton. IGFBP5 is puri	5	154-Eur	Biorb	recombinant
orb80607	Human TGF Beta 1 protein TGFB1 Human Recombinant produced in Human 293 cells is homodimeric polypeptide chain containing x 112 amino acids and having total molecular mass of 25kDa. The TGFB1 is purifi	1	154-Eur	Biorb	recombinant
orb80012	Human CNTF protein CNTF Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 199 amino acids and having a molecular mass of 22706 Dalton. The CNTF is purifie	5	154-Eur	Biorb	recombinant
AS06 174	Antibody: HSP90C | alfa-HSP90C, heat shock protein, Immunogen: C-terminal 238 amino acids of HSP90C, Q66T67, expressed with N- and C-terminal hexahistidine tags in E. coli, purified with Ni-NTA, Host:	100	337-Eur	Gentaur
orb82701	Human FGF21 protein Recombinant Human FGF21 is a single non-glycosylated polypeptide chain containing182 amino acids.Fibroblast growth factor 21 (FGF21) belongs to the large FGF family which has at le	1 mg	2079-Eur	Biorb	recombinant
orb80116	Mouse VEGF protein VEGF Mouse Recombinant produced in E.coli is a double, non-glycosylated, polypeptide chain containing 165 amino acids and having a molecular mass of 39035 Dalton.The VEGF is purifie	2	154-Eur	Biorb	recombinant
orb80115	Human VEGF protein VEGF Human Recombinant produced in E.coli is a double, non-glycosylated, polypeptide chain containing 165 amino acids and having a molecular mass of 38231 Dalton.The VEGF is purifie	2	154-Eur	Biorb	recombinant
orb81021	Human CCAAT_enhancer binding protein(C_EBP) Alpha protein CEBP-a Human Recombinant His-Tag fusion protein produced in E.coli is a single, non-glycosylated polypeptide chain containing amino acids 126	10	154-Eur	Biorb	recombinant
orb81022	Human CCAAT_enhancer binding protein(C_EBP) Gamma protein CEBP-g Recombinant Human His-Tag fusion protein produced in E.coli is a single, non-glycosylated polypeptide chain containing amino acids 146	10	154-Eur	Biorb	recombinant
SMC-384D	BK Beta4 Antibody Monoclonal, Clone number: S18A-3 Host: Mouse, Isotype: IgG2a Immunogen: Fusion protein amino acids 45-167 (entire extracellular domain) of mouse BKBeta4, accession number NP_067427.	100ug	279-Eur	Stressmarq
SMC-417D	NALCN Antibody Monoclonal, Clone number: S185-7 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 1659-1738 (cytoplasmic C-terminus) of rat NALCN, accession number Q6Q760.	100ug	279-Eur	Stressmarq
orb80823	Human IGFI Receptor protein Insulin-like growth factor receptor Human Recombinant encoding 1213-1367 amino acids expressed in E.coli, shows 43kDa band on SDS-PAGE (Including GST tag).IGF-IR is purifie	2	277-Eur	Biorb	recombinant
SMC-328D	SHANK2 Antibody Monoclonal, Clone number: S23b-6 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 84-309 (SH3_PDZ domains) of rat Shank2 (SH3 and multiple ankyrin repeat domains protei	100ug	279-Eur	Stressmarq
orb81767	Measles Virus Non-Structural C-Protein (1-51) protein The E.coli derived recombinant protein contains the Non-Structural C-Protein immunodominant regions, 1-51 amino acids. For research use only.	100	228-Eur	Biorb	recombinant
orb82685	Human Defensin beta 4 protein Recombinant Human Defensin beta 4 is a single, non-glycosylated polypeptide chain containing 50 amino acids. For research use only.	1 mg	2079-Eur	Biorb	recombinant
orb81286	Human P-Selectin protein P-Selectin Human Recombinant is expressed in E.coli containing 566 amino acids 197-761 fused to an amino terminal hexahistidine tag. For research use only.	2	154-Eur	Biorb	recombinant
orb90258	Human 6-Pyruvoyltetrahydropterin Synthase protein 6-PyruvoylTetrahydropterin Synthase Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 165 amino acids (1	5	154-Eur	Biorb	recombinant
orb81766	Measles Virus Large Polymerase (58-149) protein The E.coli derived recombinant protein contains the large polymerase immunodominant regions, 58-149 amino acids. For research use only.	100	228-Eur	Biorb	recombinant
orb81662	Cytomegalo Virus Pp28 (UL99) protein The E.coli derived recombinant protein contains the CMV Pp28 (UL99) immunodominant regions, 130-160 amino acids. For research use only.	100	228-Eur	Biorb	recombinant
orb90202	Human Ornithine Aminotransferase protein Ornithine Aminotransferase Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 408 amino acids (33-439 a.a.) and ha	5	154-Eur	Biorb	recombinant
orb81696	HIV-1 p24, Biotin Labeled protein The E.coli derived 39 kDa biotin labeled recombinant protein is non-glycosylated polypeptide chain, containing the HIV-1 p24 immunodominant regions, amino acids 77-43	100	359-Eur	Biorb	recombinant
orb80553	Bovine Placental Lactogen protein Placental Lactogen Bovine Recombinant, is a single polypeptide chain containing 199 amino acids and an additional Ala at the N-terminus having a molecular mass of 23	10	154-Eur	Biorb	recombinant
orb80554	Ovine Placental Lactogen protein Placental Lactogen Ovine Recombinant, is a single polypeptide chain containing 199 amino acids and an additional Ala at the N-terminus having a molecular mass of 23 kD	10	154-Eur	Biorb	recombinant
orb80504	Human Leptin Quadruple Antagonist protein Leptin Quadruple Mutant Human Recombinant is a single polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having Mw of 16 kDa, H	20	154-Eur	Biorb	recombinant
orb81585	Hepatitis Virus NS3 Genotype-4c (1356-1459) protein The E.coli derived recombinant protein contains the HCV NS3 immunodominant regions, amino acids 1356-1459. For research use only.	100	228-Eur	Biorb	recombinant
orb80117	Mouse VEGF (121) protein VEGF-121 Mouse Recombinant produced in E.coli is homodimer, non-glycosylated, polypeptide chain containing 121 amino acids and having a molecular mass of 28.4 kDa.Recombinant	2	154-Eur	Biorb	recombinant
orb81590	Hepatitis Virus NS3 Genotype-6a (1192-1459) protein The E.coli derived recombinant protein contains the HCV NS3 immunodominant regions, amino acids 1192-1459. For research use only.	100	228-Eur	Biorb	recombinant
orb80555	Caprine Placental Lactogen protein Placental Lactogen Caprine Recombinant, is a single polypeptide chain containing 199 amino acids and an additional Ala at the N-terminus having a molecular mass of 2	10	154-Eur	Biorb	recombinant
orb90050	Human Carbonic Anhydrase-1 protein Recombinant Human Carbonic anhydrase produced in E.coli is a single, non-glycosylated polypeptide chain containing 281 amino acids (1-261 a.a) and having a molecular	5	154-Eur	Biorb	recombinant
orb80441	Human IL12 p40 His tag protein IL12 p40 His Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 306 amino acids fragment (23-328) with an amino-terminal he	2	154-Eur	Biorb	recombinant
orb90077	Human Dopa Decarboxylase protein Dopa decarboxylase human recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 503 amino acids (1-480 a.a.) and having a molecular	5	154-Eur	Biorb	recombinant
orb81587	Hepatitis Virus NS3 Genotype-5 (1192-1459) protein The E.coli derived recombinant protein contains the HCV NS3 immunodominant regions, amino acids 1192-1459. For research use only.	100	228-Eur	Biorb	recombinant
orb90061	Human Cyclophilin A protein Cyclophilin A Human Recombinant His tag protein produced in E.coli is a single, non-glycosylated, polypeptide chain containing 185 amino acids and having a molecular mass o	10	154-Eur	Biorb	recombinant
orb80722	Human Glucagon Like Peptide-1 (7-36) protein Glucagon Like Peptide-1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 30 amino acids and having a molecu	10	154-Eur	Biorb	recombinant
orb80355	Chicken Growth Hormone protein Growth Hormone Chicken Recombinant (cGH) produced in E.coli is a single, non-glycosylated, polypeptide chain containing 191 amino acids with an additional Ala at its N-t	100	154-Eur	Biorb	recombinant
orb82765	Human PTH 1-84 protein Recombinant Human Parathyroid Hormone 1-84 is a single non-glycosylated polypeptide chain containing 84 amino acids. Polypeptide hormones secreted by the parathyroid glands, whi	1 mg	817-Eur	Biorb	recombinant
orb81220	Human Myelin Oligodendrocyte Glycoprotein Myelin Oligodendrocyte Glycoprotein produced in E.coli is a single, non-glycosylated polypeptide chain containing 132 amino acids and having a molecular mass	10	154-Eur	Biorb	recombinant
orb81219	Myelin Oligodendrocyte Glycoprotein Myelin Oligodendrocyte Glycoprotein is a single, non-glycosylated polypeptide chain containing 21 amino acids and having a molecular mass of 2582 Dalton, the molecu	5 mg	228-Eur	Biorb
orb81663	Cytomegalo Virus Pp38 (UL80a) protein The E.coli derived 52.8kDa recombinant protein contains the CMV Pp38 (UL80a) immunodominant regions, 117-373 amino acids. For research use only.	100	228-Eur	Biorb	recombinant
orb80390	Mouse Interferon-beta His Tag protein Interferon beta Mouse Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 182 amino acids (22-182 a.a.) and having a molecul	5	154-Eur	Biorb	recombinant
orb82764	Human PTH 1-34 protein Recombinant Human Parathyroid Hormone 1-34 is a single non-glycosylated polypeptide chain containing 34 amino acids. Polypeptide hormones secreted by the parathyroid glands, whi	1 mg	653-Eur	Biorb	recombinant
orb80719	Human Ghrelin protein Ghrelin Human Recombinant contains 115 amino acids (24-117 a.a.) and total molecular mass of 12.8 kDa. The GHRL is fused to 20 amino acid His Tag at N-terminus and purified by pr	5	154-Eur	Biorb	recombinant
orb81634	Hepatitis B Virus Core Delta protein The E.coli derived 14kDa recombinant protein contains the HBV core delta ayw immunodominant region amino acids 1-144. For research use only.	100	228-Eur	Biorb	recombinant
orb81583	Hepatitis Virus NS3 Genotype-2c (1356-1459) protein The E.coli derived recombinant protein contains the HCV NS3 immunodominant regions, amino acids 1356-1459. For research use only.	100	228-Eur	Biorb	recombinant
orb80440	Human IL12 p35 His tag protein IL12 p35 His Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 197 amino acids fragment (57-253) with an amino-terminal he	2	154-Eur	Biorb	recombinant
orb81135	Drosophila melanogaster GAGA-POZ protein GAGA-POZ Drosophila Melanogaster Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 130 amino acids having a molecular m	10	154-Eur	Biorb	recombinant
orb90081	Disulfide Bond Isomerase protein Disulfide-Bond Isomerase Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 216 amino acids (21-236) and having a molecular mas	10	154-Eur	Biorb	recombinant
orb81563	Hepatitis Virus Nucleocapsid (core) Genotype-6a protein The E.coli derived recombinant protein contains the HCV core nucleocapsid immunodominant regions, amino acids 2-119. For research use only.	100	228-Eur	Biorb	recombinant
orb81094	Human E-Selectin protein E-Selectin Human Recombinant is expressed in E.coli containing amino acids 179-557 fused to an amino terminal hexahistidine tag, having total molecular weight of 45.22 kDa. Fo	2	154-Eur	Biorb	recombinant
orb81562	Hepatitis Virus Nucleocapsid (core) Genotype-5 protein The E.coli derived recombinant protein contains the HCV core nucleocapsid immunodominant regions, amino acids 2-119. For research use only.	100	228-Eur	Biorb	recombinant
80200	Activated Renin, Human Recombinant Protein,Human Activated Renin (GenBank Accession No. NM_000537), amino acids 24 – 406 (end) with C-terminal HIS tag, MW=43.7 kDa, expressed in a mammalian expression	100	429-Eur	BPS Bioscience
orb81560	Hepatitis Virus Nucleocapsid (core) Genotype-3b protein The E.coli derived recombinant protein contains the HCV core nucleocapsid immunodominant regions, amino acids 2-119. For research use only.	100	228-Eur	Biorb	recombinant
orb80507	Rat Leptin Triple Antagonist protein Leptin Antagonist Triple Mutant Rat Recombinant is singly non-glycosilated polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having	20	154-Eur	Biorb	recombinant
31108	BRDT (22-138), GST-tag, Human Recombinant Protein,Human Bromodomain testis-specific protein, also known as BRDT, BRD6, and CT9, amino-acids 22 – 138 (GenBank Accession No. NM_207189) with N-terminal G	100	429-Eur	BPS Bioscience
orb81555	Hepatitis Virus Nucleocapsid (core) Genotype-1a protein The E.coli derived recombinant protein contains the HCV core nucleocapsid immunodominant regions, amino acids 2-119. For research use only.	100	228-Eur	Biorb	recombinant
orb81581	Hepatitis Virus NS3 Genotype-2b (1192-1459) protein The E.coli derived recombinant protein contains the HCV NS3 immunodominant regions, amino acids 1192-1459. For research use only.	100	228-Eur	Biorb	recombinant
orb81554	Hepatitis Virus Nucleocapsid (core) Genotype-1 protein The E.coli derived recombinant protein contains the HCV core nucleocapsid immunodominant regions, amino acids 1-102. For research use only.	100	228-Eur	Biorb	recombinant
orb80866	Human Phosphoserine Phosphatase protein Phosphoserine Phosphatase Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 225 amino acids and having a molecular	5	154-Eur	Biorb	recombinant
orb82749	Human MIP1 alpha protein Recombinant human Macrophage Inflammatory Protein 1-alpha is a single, nonglycosylated polypeptide chain containing 69 amino acids. For research use only.	1 mg	2079-Eur	Biorb	recombinant
EIAAB25508	Beta-microseminoprotein,MSMB,Pig,Prostate secreted seminal plasma protein,Prostate secretory protein of 94 amino acids,PSP94,PSP94,PSP-94,Sus scrofa,TS507		1333-Eur	EIAab
orb81580	Hepatitis Virus NS3 Genotype-2c (1192-1459) protein The E.coli derived recombinant protein contains the HCV NS3 immunodominant regions, amino acids 1192-1459. For research use only.	100	228-Eur	Biorb	recombinant
orb80534	Human Omentin His Tag protein Omentin Human Recombinant is produced in E.coli by recombinant DNA technology is a single, polypeptide chain containing 294 amino acids and having a molecular mass of 32.	2	154-Eur	Biorb	recombinant
orb80533	Human Omentin protein Omentin Human Recombinant is produced in E.coli by recombinant DNA technology is a single, polypeptide chain containing 313 amino acids and having a molecular mass of 35 kDa. Int	2	154-Eur	Biorb	recombinant
orb80404	Human IL1 alpha His tag protein Human IL1 alpha Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 159 amino acids fragment (113-271) with an amino-terminal hex	5	154-Eur	Biorb	recombinant
EIAAB25510	Beta-microseminoprotein,Msmb,Prostate secreted seminal plasma protein,Prostate secretory protein of 94 amino acids,PSP94,Psp94,PSP-94,Rat,Rattus norvegicus		1191-Eur	EIAab
orb81586	Hepatitis Virus NS3 Genotype-5 (1356-1459) protein The E.coli derived recombinant protein contains the HCV NS3 immunodominant regions, amino acids 1356-1459. For research use only.	100	228-Eur	Biorb	recombinant
EIAAB25507	Beta-microseminoprotein,Mouse,Msmb,Mus musculus,Prostate secreted seminal plasma protein,Prostate secretory protein of 94 amino acids,PSP94,Psp94,PSP-94		1164-Eur	EIAab
orb81773	Rubella Virus E1 Mosaic protein The E.coli derived recombinant protein contains the Rubella Virus E1 regions, 157-176, 374-390, 213-239 amino acids. For research use only.	100	228-Eur	Biorb	recombinant
orb60023	Teriparatide Teriparatide(Forteo) is recombinant parathyroid hormone, identical to the 34 N-terminal amino acids of human parathyroid hormone (PTH). For research use only.	25 mg	324-Eur	Biorb	recombinant
orb82671	Human CD40 Ligand protein Recombinant human CD40 Ligand is a non-glycosylated polypeptide chain containing 149 amino acids. For research use only.	1 mg	1178-Eur	Biorb	recombinant
orb80038	Human Interferon-alpha 2a protein Interferon Alpha Human 2a Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 165 amino acids and having a molecular mass of 19	20	154-Eur	Biorb	recombinant
orb80773	Human Activating Transcription Factor-2 protein Activating Transcription Factor-2Human Recombinant produced in E.coli is non-glycosylated, polypeptide chain encoding 19-96 amino acids and having a mol	2	154-Eur	Biorb	elisa
orb80385	Human Interferon-alpha 1a protein Interferon-alpha 1a Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 165 amino acids and having a molecular mass of 19	20	154-Eur	Biorb	recombinant
26-106	Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-	0.05 mg	632-Eur	Prosci	rna
orb82834	Rhesus macaque IL1 beta protein Recombinant Rhesus Macaque IL1 beta_IL1F2 is a single non-glycosylated polypeptide chain containing 153 amino acids. IL1 beta is a proinflammatory cytokine produced in	1 mg	3143-Eur	Biorb	recombinant
27-187	Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-	0.05 mg	632-Eur	Prosci	rna
orb80037	Human Interferon-alpha 1b protein Interferon-alpha 1b Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 166 amino acids and having a molecular mass of 19	2	154-Eur	Biorb	recombinant
orb80772	Human AKT1 protein AKT1 Human Recombinant produced in SF9 is glycosylated, polypeptide chain containing 481 amino acids and having a molecular mass of 60 KD. This protein is the full-length form of th	2	154-Eur	Biorb	recombinant
orb81170	Human Intercellular Adhesion Molecule-1 protein ICAM-1 Human Recombinant is expressed in E.coli containing 455 amino acids 28-483 fused to an amino terminal hexahistidine tag.The ICAM-1 is purified by	2	154-Eur	Biorb	recombinant
orb80769	Human Adenosine Kinase protein Adenosine Kinase Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 362 amino acids (22-362a.a.) and having a molecular mas	2	154-Eur	Biorb	recombinant
orb80040	Human Interferon-alpha 2b, Saccharomyces protein Interferon-alpha 2b Human Recombinant produced in yeast is a single, glycosylated, polypeptide chain containing 165 amino acids and having a molecular	20	154-Eur	Biorb	recombinant
orb80571	Ovine Prolactin Antagonist protein Prolactin Ovine Antagonist Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 199 amino acids and having a molecular mass of 2	10	154-Eur	Biorb	recombinant
orb82719	Human IL13 Variant protein Recombinant Human IL13 Variant is a single non-glycosylated polypeptide chain containing 114 amino acids, with a substitution of Q for R (glutamine for arginine) at position	1 mg	2799-Eur	Biorb	recombinant
30-809	Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-	0.05 mg	632-Eur	Prosci	rna
orb81209	Human Microtubule-Associated Protein Light Chain Alpha protein MAP1LC3A Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 128 amino acids (1-120 a.a.) and	5	154-Eur	Biorb	recombinant
orb80680	Human MIP1 alpha His tag protein Macrophage Inflammatory Protein-1 alpha His Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 68 amino acids and having	2	154-Eur	Biorb	recombinant
orb81201	Human L-Selectin protein L-Selectin Human Recombinant is expressed in E.coli containing 294 amino acids 39-332 fused to an amino terminal hexahistidine tag, having total molecular weight of 37.55kDa.	2	154-Eur	Biorb	recombinant
orb80483	Porcine Insulin protein Insulin Porcine is two chain, glycosylated polypeptide chain containing 51 amino acids and having a molecular mass of 5777 Dalton. The and chains are joined by two interchain d	25 mg	211-Eur	Biorb	porcine
orb80004	Human beta Defensin 4 protein Beta Defensin-4 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 50 amino acids and having a molecular mass of kDa. The BD-	5	154-Eur	Biorb	recombinant
30-195	Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-	0.1 mg	496-Eur	Prosci	rna
orb80410	Human IL1 Receptor Antagonist His tag protein IL1 alpha Receptor Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 152 amino acids f alpha Receptorgment	10	228-Eur	Biorb	recombinant
orb80579	Human Sonic HedgeHog His tag protein Sonic HedgeHog Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 183 amino acids and having a molecular mass of 20.7k	5	154-Eur	Biorb	recombinant
orb80479	Human IL32 alpha His Tag protein Human IL32 alpha recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 168 amino acids (1-131 a.a.) and having a molecular mass of	5	154-Eur	Biorb	recombinant
29-314	Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-	0.05 mg	632-Eur	Prosci	rna
29-313	Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-	0.1 mg	496-Eur	Prosci	rna
orb80600	Rat Stem Cell Factor protein Stem cell factor Rat Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 164 amino acids (26-189) and having a molecular mass of 18.4	2	154-Eur	Biorb	recombinant
orb81431	Rat Tropic 1808 protein Tropic-1808 Human Recombinant protein fused to N-terminal His-Tag produced in E.coli is a single, non-glycosylated polypeptide chain containing 285 amino acids and having a mol	10	154-Eur	Biorb	recombinant
orb80580	Mouse Sonic HedgeHog protein Sonic Hedgehog Recombinant Mouse produced in E.coli is a single, non-glycosylated polypeptide chain containing 176 amino acids and having a molecular mass of 19.8 kDa. The	5	154-Eur	Biorb	recombinant
orb80572	Ovine Prolactin Antagonist, Mutant protein Prolactin Ovine Antagonist Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 199 amino acids and an additional Ala at	10	154-Eur	Biorb	recombinant
orb80564	Human Prolactin Receptor GST Tag protein Cytoplasmatic Prolactin Receptor Human Recombinant produced in E.coli is non-glycosylated, Polypeptide chain amino acids 432-623 and having a molecular mass of	2	277-Eur	Biorb	recombinant
orb80545	Human PDGF B protein PDGF-B Human Recombinant mature chain produced in E.coli is non-glycosylated, polypeptide chain containing 109 amino acids fragment (82-190) and having a molecular mass of 16.75 k	5	154-Eur	Biorb	recombinant
orb80358	Bovine Growth Hormone protein Growth Hormone Bovine Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 191 amino acids and having a molecular mass of 21.8 kDa. T	100	154-Eur	Biorb	recombinant
orb80074	Human IL13 Variant protein IL13 Variant Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 114 amino acids, with a substitution of Q for R at position 112	2	154-Eur	Biorb	recombinant
orb90286	Human Thyroid Peroxidase protein Thyroid Peroxidase Human Recombinant produced in SF9 is glycosylated, polypeptide chain containing 834 amino acids and having a molecular mass of 92,872 Dalton (exclud	5	154-Eur	Biorb	recombinant
SMC-404D	Anti-Ankyrin-G Protein, S106-20 Monoclonals AntibodiesS106-20 Fusion protein 1000 C-terminal amino acids of human Ankyrin G encompassing all of Ankyrin G with the exception of Ankyrin repeats	100ug	324-Eur	Stressmarq
orb80169	Human Parathyroid Hormone (7-34) protein Parathyroid Hormone Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 28 amino acids and having a molecular mass	20	154-Eur	Biorb	recombinant
orb80168	Human Parathyroid Hormone (1-84) protein Parathyroid Hormone 1-84 (full length) Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 84 amino acids, having	20	154-Eur	Biorb	recombinant
orb81751	Epstein-Barr Virus (HHV-4) Early Antigen protein The E.coli derived 35.5 kDa recombinant protein contains the HHV-4 Early Antigen Type D, C-terminus regions amino acids 306-390. For research use only.	100	228-Eur	Biorb	recombinant
orb80167	Human Parathyroid Hormone (1-34) protein Parathyroid Hormone Human Recombinant (C181H290N55O51S2) produced in E.coli is a single, non-glycosylated, polypeptide chain containing 34 amino acids and havi	20	154-Eur	Biorb	recombinant
orb81666	Cytomegalo Virus Pp150(UL32) protein The E.coli derived recombinant protein contains the CMV Pp150 (UL32) immunodominant regions, 1011-1048 amino acids. For research use only.	100	228-Eur	Biorb	recombinant
orb81096	Human FABP1 protein FABP1 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 147 amino acids and having a molecular mass of 16 kDa. The protein is fused to	5	154-Eur	Biorb	recombinant
orb80753	Human Parathyroid Hormone (1-34) protein Parathyroid Hormone Human Synthetic (C181H290N55O51S2) contains 34 amino acids and has molecular mass of 4117.8 Dalton. The PTH is purified by proprietary chro	200	154-Eur	Biorb	human
orb81706	HIV-1 gp41 Long, Biotin Labeled protein The E.coli derived 32 kDa biotin labeled recombinant protein is non-glycosylated polypeptide chain, containing the HIV-1 p41 immunodominant regions, amino acids	100	359-Eur	Biorb	recombinant
orb90190	Human Myeloperoxidase protein Myeloperoxidase Human Recombinant protein encoding amino acids 621-745 expressed in E.coli, shows 50 kDa band on SDS-PAGE (Including GST).The MPO purified by proprietary	2	277-Eur	Biorb	recombinant
orb81485	Human DnaJ (HSP40) protein HSP40 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 360 amino acids and having a molecular mass of 40.2 kDa. The protein in	5	154-Eur	Biorb	recombinant
orb80002	Human beta Defensin 2 protein Beta Defensin-2 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 41 amino acids and having a molecular mass of 4.3 kDa. The	5	154-Eur	Biorb	recombinant
orb80389	Mouse Interferon-beta protein Interferon beta Mouse Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 162 amino acids and having a molecular mass of 19.8 kDa.Mo	2	154-Eur	Biorb	recombinant
orb80087	Mouse Leukemia Inhibitory Factor protein Leukemia Inhibitory Factor (LIF) Murine Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 181 amino acids and having a	5	154-Eur	Biorb	recombinant
orb80001	Human beta Defensin 1 protein Beta Defensin-1 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 47 amino acids and having a molecular mass of kDa.The BD-1	5	154-Eur	Biorb	recombinant
orb80935	Human Copper Transport Protein ATOX1 protein ATOX1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 88 amino acids (1-68 a.a.) and having a molecular ma	5	154-Eur	Biorb	recombinant
orb80552	Human Placental Lactogen protein Placental Lactogen Human Recombinant, is a single polypeptide chain containing 199 amino acids and an additional Ala at the N-terminus having a molecular mass of appro	10	154-Eur	Biorb	recombinant
orb80635	Human VEGF, Yeast protein VEGF Human Recombinant produced in Yeast is a double, glycosylated, polypeptide chain containing 165 amino acids and having a molecular mass of 42 kDa. For research use only.	2	154-Eur	Biorb	recombinant
orb81564	Hepatitis Virus Nucleocapsid (core) Genotype-3_10 protein The E.coli derived recombinant protein contains the HCV core nucleocapsid immunodominant regions, amino acids 2-119. For research use only.	100	228-Eur	Biorb	recombinant
orb81774	Rubella Virus E2 protein The E.coli derived recombinant protein contains the Rubella Virus E2 regions, 31-105 amino acids. For research use only.	100	228-Eur	Biorb	recombinant
SMC-300D	CaV1.2 Antibody Monoclonal, Clone number: S57-46 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 1507-1733 (intracellular carboxyl terminus) of rabbit Cav1.2, accession number P15381	100ug	279-Eur	Stressmarq
orb81572	Hepatitis Virus Nucleocapsid (core) 22kDa, Fluorescein Labeled protein The E.coli derived recombinant protein contains the HCV core nucleocapsid immunodominant regions, amino acids 2-192. The Fluoresc	100	359-Eur	Biorb	recombinant
SMC-328D	SHANK2, S23b-6 Monoclonals AntibodiesS23b-6 Fusion protein amino acids 84-309 (SH3_PDZ domains) of rat Shank2 (SH3 and multiple ankyrin repeat domains protein 2 (accession number Q9QX74)	100ug	324-Eur	Stressmarq
orb81707	HIV-1 gp41 Long, Horseradish peroxidase Labeled protein The E.coli derived HRP Labeled protein contains the full-length sequence of N-terminal epitopes of HIV-I gp41, 160 amino acids (513-674) immunod	100	359-Eur	Biorb	recombinant
AS08 345	Antibody: Toc75 | Protein TOC75-3, chloroplastic, POTRA domain 1, Immunogen: psTOC75; Predicted POTRA Domain #1; Amino acids, 158-241; Expressed and purified in E. coli using the Impact System from NE	200	337-Eur	Gentaur
orb80734	Human Inhibin-Alpha protein Inhibin-Alpha Human Recombinant produced in E.coli is non-glycosylated, polypeptide chain containing 264 amino acids comprising of both and chains, having a molecular mass	2	154-Eur	Biorb	recombinant
orb81212	Human Matlose Binding protein Maltose Binding Protein Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 387 amino acids and having a molecular mass of 42	50	154-Eur	Biorb	recombinant
orb80745	Human Octreotide protein Octreotide Human Synthetic is a single, non-glycosylated, polypeptide chain containing amino acids, having a molecular mass of 1019.26 Dalton and a molecular formula of C49H66	1 mg	154-Eur	Biorb	human
orb80386	Human Interferon-alpha 2a, Tobacco protein Interferon Alpha Human 2a Recombinant produced in Plant is a single, glycosylated, polypeptide chain containing 165 amino acids and having a molecular mass o	5	154-Eur	Biorb	recombinant
orb80041	Human Interferon-gamma protein Interferon-gamma Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 144 amino acids and having a molecular mass of 16879 Da	20	154-Eur	Biorb	recombinant
orb80392	Porcine Interferon-gamma protein Interferon-gamma Porcine Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 146 amino acids and having a molecular mass of 1714	10	154-Eur	Biorb	recombinant
orb81377	Human Superoxide Dismutase-1 protein Recombinant Human Cu_Zn Superoxide Dismutase produced in E.coli is a single monomeric non-glycosylated polypeptide chain containing 154 amino acids and having tota	5	154-Eur	Biorb	recombinant
orb80100	Human Sonic HedgeHog protein Sonic HedgeHog Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 175 amino acids and having a molecular mass of 19,683 Dalton	5	154-Eur	Biorb	recombinant
orb80478	Human IL32 alpha protein Human IL32 alpha recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 131 amino acids and having a molecular mass of 14.9 kDa. For resear	2	154-Eur	Biorb	recombinant
orb80687	Mouse MIP3 alpha protein Macrophage Inflammatory Protein-3 alpha Mouse Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 70 amino acids and having a molecular	5	154-Eur	Biorb	recombinant
orb80566	Rabbit Prolactin Soluble Receptor protein Prolactin Receptor Rabbit Extra Celleular Domain Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 207 amino acids and having a	10	154-Eur	Biorb	recombinant
orb80387	Human Interferon-beta 1a protein Interferon-beta 1a Human Recombinant produced in CHO (Chinese Hamster Ovarian) cells is a single, glycosylated polypeptide chain containing 166 amino acids and having	2	154-Eur	Biorb	recombinant
orb81566	Hepatitis Virus Nucleocapsid (core), Horseradish Peroxidase Labled protein The E.coli derived recombinant HRP Labeled protein contains the HCV core nucleocapsid immunodominant regions, amino acids 2-1	100	359-Eur	Biorb	recombinant
orb80359	Mouse Growth Hormone protein Growth Hormone Mouse Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 191 amino acids and having a molecular mass of 22 kDa. Mous	100	539-Eur	Biorb	recombinant
orb80681	Mouse MIP1 alpha protein Macrophage Inflammatory Protein-1 alpha Mouse Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 69 amino acids and having a molecular	2	154-Eur	Biorb	recombinant
orb82653	Bovine FGF basic protein Recombinant bovine Fibroblast Growth Factor 2 is a single, non-glycosylated polypeptide chain containing 172 amino acids. less than _pGreater thanbFGF is a single-chain polype	1 mg	1260-Eur	Biorb	recombinant
orb80150	Human MIP1 alpha protein Macrophage Inflammatory Protein-1 alpha Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 70 amino acids and having a molecular	5	154-Eur	Biorb	recombinant
orb80361	Carp Growth Hormone protein Growth Hormone Carp Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 188 amino acids having a molecular mass of 21,408 Dalton. Gro	100	359-Eur	Biorb	recombinant
orb80151	Human MIP1 beta protein Macrophage Inflammatory Protein-1 beta Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 69 amino acids and having a molecular ma	2	154-Eur	Biorb	recombinant
orb80568	Bovine Prolactin Soluble Receptor protein Prolactin Receptor Bovine Extra Celleular Domain Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 213 amino acids and having a	10	154-Eur	Biorb	recombinant
orb80378	Human HDGF protein The HDGF Human recombinant protein is a single, non-glycosilated polypeptide chain produced in E.coli, having molecular weight of 11.5kDa and containing 100 amino acids. For researc	5	154-Eur	Biorb	recombinant
orb80684	Human MIP3 beta protein Macrophage Inflammatory Protein-3 beta Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 77 amino acids and having a molecular ma	5	154-Eur	Biorb	recombinant
orb80042	Mouse Interferon-gamma protein Interferon-gamma Mouse Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 134 amino acids and having a molecular mass of 15601 Da	20	154-Eur	Biorb	recombinant
orb80686	Mouse MIP3 beta protein Macrophage Inflammatory Protein-3 beta Mouse Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 83 amino acids and having a molecular ma	5	154-Eur	Biorb	recombinant
orb81451	Human Ubiquitin Biotin protein Recombinant Human RPS27A protein biotinylated with NHS-biotin produced in E.coli is a single, non-glycosylated polypeptide chain containing total of 76 amino acids and h	2	154-Eur	Biorb	recombinant
orb80489	Pegylated Mouse Leptin protein Leptin Mono-Pegylated Mouse Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 146 amino acids and an additional Ala at N-terminu	5	154-Eur	Biorb	recombinant
orb80683	Mouse MIP1 beta protein Macrophage Inflammatory Protein-1 beta Mouse Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 69 amino acids and having a molecular ma	2	154-Eur	Biorb	recombinant
orb80343	Human GDF15 H-Variant protein GDF15 H-variant Human Recombinant produced in E.coli is homodimeric, non-glycosylated, Polypeptide chain containing 2x113 amino acids and having a molecular mass of 24.8	2	154-Eur	Biorb	recombinant
orb80567	Ovine Prolactin Soluble Receptor protein Prolactin Receptor Ovine Extra Celleular Domain Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 213 amino acids and having a m	10	154-Eur	Biorb	recombinant
orb81750	Epstein-Barr Virus (HHV-4) EBNA1 His tag protein The E.coli derived recombinant protein contains the HHV-4 EBNA1 regions 408-641 amino acids having a molecular mass of 24.8kDa. The EBNA1 protein is fu	100	359-Eur	Biorb	recombinant
orb81257	Human Paxillin protein Paxillin Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 203 amino acids (356-558 a.a.) having total Mw of 48kDa. Human Paxillin	2	277-Eur	Biorb	recombinant
orb81342	Human S100 Calcium Binding Protein B protein S100B Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 91 amino acids fragment (2-92) with an amino-termina	5	154-Eur	Biorb	recombinant
orb80897	Human Actin Gamma protein Actin Gamma Human Recombinant produced in E.coli is non-glycosylated, polypeptide chain containing amino acids (1-375) and having total molecular mass of 41.8 kda. ACTG1 cont	2	154-Eur	Biorb	recombinant
orb80365	Rabbit Growth Hormone protein Growth Hormone Rabbit Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 190 amino acids and having a molecular mass of 21774 Dalt	100	359-Eur	Biorb	recombinant
orb80104	Human Trefoil Factor-1 protein TFF-1 Human Recombinant produced in E.coli is homodimer, non-glycosylated, polypeptide chain containing x 60 amino acids which includes 40 amino acid trefoil motif conta	5	154-Eur	Biorb	recombinant
orb80565	Human Prolactin Receptor protein Extra Cellular Domain Prolactin Receptor Human Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containsing 210 amino acids and having a molecular	10	154-Eur	Biorb	recombinant
orb80790	Human Protein kinase Casein Kinase alpha His tag protein CK2A Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain encoding the sequence of 411 amino acids and having	2	154-Eur	Biorb	recombinant
orb80003	Human beta Defensin 3 protein Beta Defensin-3 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 45 amino acids and having a molecular mass of 5161.2 Dalto	5	154-Eur	Biorb	recombinant
orb80718	Human Ghrelin protein Ghrelin Human contains 28 amino acids and total molecular mass of 3370.9 Dalton and a molecular formula of C149H249N47O42.The GHRL is purified by proprietary chromatographic tech	1 mg	154-Eur	Biorb	human
orb80362	Denis Growth Hormone protein Growth Hormone Denis Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 190 amino acids and having a molecular mass of 21810 Dalton	100	359-Eur	Biorb	recombinant
PHP054	RECOMBINANT HUMAN INTERLEUKIN_8 (77 AMINO ACIDS), Product Type Recombinant Protein, Specificity IL_8, Target Species Human, Host N_A, Format Rec. Protein, Isotypes , Applications FN, Clone	25 µg	290-Eur	AbD	recombinant
SCH-PHP055	RECOMBINANT HUMAN INTERLEUKIN_8 (72 AMINO ACIDS), Product Type Recombinant Protein, Specificity IL_8, Target Species Human, Host N_A, Format Rec. Protein, Isotypes , Applications FN, Clone	25 µg	444-Eur	Serotech	recombinant
orb80356	Ovine Growth Hormone protein Growth Hormone Ovine Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 200 amino acids and having a molecular mass of 22015 Dalton.	100	154-Eur	Biorb	recombinant
PHP055	RECOMBINANT HUMAN INTERLEUKIN_8 (72 AMINO ACIDS), Product Type Recombinant Protein, Specificity IL_8, Target Species Human, Host N_A, Format Rec. Protein, Isotypes , Applications FN, Clone	25 µg	444-Eur	AbD	recombinant
SMC-310D	Kir2.1 Antibody Monoclonal, Clone number: S112B-14 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 41-64 and 189-428 of mouse Kir2.1, accession number NP_032451.	100ug	279-Eur	Stressmarq
MA1005	Monoclonal Anti-BIN1, Clone number: BN-1, Ig type: mouse IgG2b, Immunogen: Recombinant polypeptide containing amino acids 189-398 of human Bin1., Specificity: Human;mouse;rat. No cross reactivity with	100μg/vial	232-Eur	Bouster Immunoleader
orb81320	Human Serum Albumin protein Recombinant Human Serum Albumin produced in yeast is a single, non-glycosylated, polypeptide chain containing 585 amino acids and having a molecular mass of 66441 Dalton.Th	10 mg	293-Eur	Biorb	recombinant
orb81607	Hepatitis Virus NS5 Genotype-1a (2322-2423) protein The E.coli derived recombinant protein contains the HCV NS5 Genotype1a immunodominant regions, amino acids 2322-2423 having total Mw of 38.34kD whic	100	228-Eur	Biorb	recombinant
SMC-324D	Slo2.1 Antibody Monoclonal, Clone number: S11-33 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 564-624 of mouse Slo2.1 (Slick), accession number XP_920840	100ug	279-Eur	Stressmarq
SCH-PHP054	RECOMBINANT HUMAN INTERLEUKIN_8 (77 AMINO ACIDS), Product Type Recombinant Protein, Specificity IL_8, Target Species Human, Host N_A, Format Rec. Protein, Isotypes , Applications FN, Clone	25 µg	290-Eur	Serotech	recombinant
orb80295	Human EBI3 protein EBI3 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 209 amino acids and having a molecular mass of 23.3 kDa. The Human EBI3 is purif	2	154-Eur	Biorb	recombinant
orb80098	Human PEDF protein PEDF Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 400 amino acids and having a molecular mass of 44.5 kDa. The Human PEDF is puri	5	154-Eur	Biorb	recombinant
orb81163	Human Holo Transferrin protein Human Holo Transferrin is glycoprotein of approximately 77 kDa containing 679 amino acids. For research use only.	500 mg	359-Eur	Biorb	human
bs-1439P	Peptides: JAK1(Tyrosine-protein kinase JAK1; Janus kinase 1) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0908P	Peptides: JAK2(Tyrosine-protein kinase JAK2; Janus kinase 2; JAK-2) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
orb80270	Human BDNF protein BDNF Human Recombinant produced in E.coli is homodimer, non-glycosylated, polypeptide chain containing x 119 amino acids and having total molecular mass of 26,984 Dalton. BDNF Human	2	154-Eur	Biorb	recombinant
orb80693	Mouse Rantes protein Rantes Mouse Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 68 amino acids and having a molecular mass of 7876 Dalton. The Mouse Rantes	5	154-Eur	Biorb	recombinant
NU-829-485XL	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - DY-485XL	80	746-Eur	Jena Bio
NU-807-480XL	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - DY-480XL	80	746-Eur	Jena Bio
NU-807-485XL	Nucleic acids: 8-[(6-Amino)hexyl]-amino-ATP - DY-485XL	80	746-Eur	Jena Bio
NU-829-480XL	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GMP - DY-480XL	80	746-Eur	Jena Bio
NU-830-480XL	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - DY-480XL	80	746-Eur	Jena Bio
NU-830-485XL	Nucleic acids: 8-[(6-Amino)hexyl]-amino-GTP - DY-485XL	80	746-Eur	Jena Bio
SMC-331D	BK Beta2 Antibody Monoclonal, Clone number: S53-32 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 1-41 (N-terminus) and 218-235 (C-terminus) of mouse BKBeta2 (accession number Q9CZM9	100ug	279-Eur	Stressmarq
SMC-306D	HCN3 Antibody Monoclonal, Clone number: S141-28 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 660-779 (C terminus) of mouse HCN3, accession number O88705	100ug	279-Eur	Stressmarq
MA1080	Monoclonal Anti-Paxillin, Clone number: PAX-14, Ig type: mouse IgG1, Immunogen: C-terminal part of recombinant chicken paxillin (amino acids 305-559)., Specificity: Human;mouse;rat;chicken. No cross r	100μg/vial	232-Eur	Bouster Immunoleader
SMC-425D	Synaptotagmin-6 Antibody Monoclonal, Clone number: S270-47 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 246-333 (Cytoplasmic C2A domain) of mouse Synaptotagmin-6, accession number	100ug	279-Eur	Stressmarq
SMC-426D	Synaptotagmin-3 Antibody Monoclonal, Clone number: S278-19 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 442-533 (Cytoplasmic C2B domain) of mouse Synaptotagmin-3, accession number	100ug	279-Eur	Stressmarq
SMC-436D	Synaptotagmin-9 Antibody Monoclonal, Clone number: S276A-15 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 253-344 (Cytoplasmic C2B domain) of mouse Synaptotagmin-9, accession number	100ug	279-Eur	Stressmarq
SMC-437D	Synaptotagmin-12 Antibody Monoclonal, Clone number: S277-7 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 168-255 (Cytoplasmic C2A domain) of mouse Synaptotagmin-12, accession number	100ug	279-Eur	Stressmarq
SMC-326D	Slo3 Antibody Monoclonal, Clone number: S2-16 Host: Mouse, Isotype: IgG2b Immunogen: Fusion protein amino acids 1052-1121 of mouse Slo3; accession number AAB99742	100ug	279-Eur	Stressmarq
orb80569	Raibow Trout Prolactin Soluble Receptor protein Prolactin Receptor Rainbow Trout Extra Celleular Domain Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 210 amino acids	10	154-Eur	Biorb	recombinant
AS07 256	Antibody: SAL1 | sal1 phosphatase, Immunogen: recombinant SAL1, full-length protein, 353 amino acids. The cDNA of SAL1 (At5g63980, protein Q42546) was cloned into pHUE expression vector and the prote	100	337-Eur	Gentaur
SMC-424D	Synaptotagmin-7 Antibody Monoclonal, Clone number: S275-14 Host: Mouse, Isotype: IgG2B Immunogen: Fusion protein amino acids 150-239 (Cytoplasmic C2A domain) of mouse Synaptotagmin-7, accession number	100ug	279-Eur	Stressmarq
NU-1104S	Nucleic acids: Etheno-AppNHp (epsilon-AppNHp), S pack (1,N6-Etheno-AppNHp)	5Units	128-Eur	Jena Bio
NU-1104L	Nucleic acids: Etheno-AppNHp (epsilon-AppNHp), L pack (1,N6-Etheno-AppNHp)	25Units	316-Eur	Jena Bio
SMC-415D	LRP4 (cytoplasmic) Antibody Monoclonal, Clone number: S164-6 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 1747-1905 (cytoplasmic C-terminus) of mouse LRP4	100ug	279-Eur	Stressmarq
SMC-345D	GABA-A Receptor Delta Antibody Monoclonal, Clone number: S151-3 Host: Mouse, Isotype: IgG2a Immunogen: Synthetic peptide amino acids 15-34 of rat GABA-A-R-Delta, accession number P18506	100ug	279-Eur	Stressmarq
SMC-346D	GABA-A Receptor Alpha-1 Antibody Monoclonal, Clone number: S95-35 Host: Mouse, Isotype: IgG2A Immunogen: Fusion protein amino acids 355-394 of mouse GABA-A-R-Alpha1, accession number P62812	100ug	279-Eur	Stressmarq
AS06 110	Antibody: PsbC | CP43 protein of PSII, Immunogen: recombinant protein loop amino acids 257-450 of Arabidopsis thaliana PsbC AtCg00280, Host: rabbit, polyclonal, Confirmed reactivity: Arabidopsis thali	150	----Eur	Gentaur
SMC-316D	TrpM7 Antibody Monoclonal, Clone number: S74-25 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 1817-1863 (C- terminus) of mouse TrpM7, accession number Q923J1	100ug	279-Eur	Stressmarq
SMC-427D	ASIC1 Antibody Monoclonal, Clone number: S271-44 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 460-526 (Cytoplasmic C-terminus) of mouse ASIC1, accession number Q6NXK8	100ug	279-Eur	Stressmarq
NU-803-RHOX	Nucleic acids: Rhodamine-12-dUTP Rhodamine-X-5-Aminoallyl-dUTPRho-green-X-dUTP, RhG-dUTP, R110-dUTP	30	218-Eur	Jena Bio
NU-819L	Nucleic acids: gamma-[(2-Aminoethyl)-imido]-AppNHp, L pack (gamma-[(2-Aminoethyl)-imido]-AMPPNP)	150Units	316-Eur	Jena Bio
NU-819S	Nucleic acids: gamma-[(2-Aminoethyl)-imido]-AppNHp, S pack (gamma-[(2-Aminoethyl)-imido]-AMPPNP)	30Units	128-Eur	Jena Bio
NU-809-RHOX	Nucleic acids: Rhodamine-12-dCTP Rhodamine-X-5-propargylamino-dCTPRho-green-X-dCTP, RhG-dCTP, R110-dCTP	30	209-Eur	Jena Bio
SMC-439D	Versican Antibody Monoclonal, Clone number: S351-23 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 362-585 (glycosaminoglycan alpha domain) of mouse Versican core protein, accession	100ug	279-Eur	Stressmarq
SMC-416D	Dicer Antibody Monoclonal, Clone number: S167-7 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 1638-1899 of mouse Endoribonuclease Dicer accession number Q8R418.	100ug	279-Eur	Stressmarq
SMC-418D	LRP4 (extracellular) Antibody Monoclonal, Clone number: S207-27 Host: Mouse, Isotype: IgG2A Immunogen: Fusion protein amino acids 26-350 (extracellular N-temrinus) of mouse LTP4, accession number Q8VI	100ug	279-Eur	Stressmarq
BS-010309-BK	External probe - Probe type- thermocouple - Connector type- К - Cable- PTFE flat two core, good mechanical strength & flexibility, resistant to oils, acids, adverse agents, fluids - Cable length- 1 m		95-Eur	Biosan
orb82771	Human SPARC His tag protein Recombinant Human SPARC is a single non-glycosylated polypeptide chain containing 295 amino acids with an n-terminal His tag. SPARC, an acronym for secreted protein, acidic	1 mg	1489-Eur	Biorb	recombinant
orb82717	Human IL12 p70 protein Recombinant Human IL12 is a glycosylated heterodimeric polypeptide containing 503 amino acids. IL12 is a heterodimeric cytokine that stimulates the production of interferon gamm	1 mg	4929-Eur	Biorb	recombinant
orb81557	Hepatitis Virus Nucleocapsid (core) Genotype-2a protein The E.coli derived recombinant protein contains the HCV core nucleocapsid immunodominant regions, amino acids 2-119. The protein is fused to GST	100	228-Eur	Biorb	recombinant
orb81604	Hepatitis Virus NS4 a+b, Rhodamine Labeled protein The E.coli derived 19 kDa recombinant protein rhodamine labeled contains the HCV NS4 immunodominant regions, amino acids 1658-1863. The protein is fu	100	359-Eur	Biorb	recombinant
orb80287	Human CNTF His tag protein CNTF Recombinant Human produced in E.coli is a single, non-glycosylated polypeptide chain containing 220 amino acids and having a molecular mass of 25 kDa. The CNTF protein	5	154-Eur	Biorb	recombinant
orb81561	Hepatitis Virus Nucleocapsid (core) Genotype-4 protein The E.coli derived recombinant protein contains the HCV core nucleocapsid immunodominant regions, amino acids 2-119. The protein is fused to GST	100	228-Eur	Biorb	recombinant
orb82700	Human FGF19 protein Recombinant Human Fibroblast Growth FGF19 (FGF19) is a single non-glycosylatedpolypeptide chain containing 195 amino acids. less than _pGreater thanFibroblast Growth Factor 19 (FGF	1 mg	2079-Eur	Biorb	recombinant
orb81556	Hepatitis Virus Nucleocapsid (core) Genotype-1b protein The E.coli derived recombinant multimer protein contains the HCV core nucleocapsid immunodominant regions, amino acids 2-119. The protein is fus	100	228-Eur	Biorb	recombinant
orb81559	Hepatitis Virus Nucleocapsid (core) Genotype-3a protein The E.coli derived recombinant protein contains the HCV core nucleocapsid immunodominant regions, amino acids 2-119. The protein is fused to GST	100	228-Eur	Biorb	recombinant
orb81558	Hepatitis Virus Nucleocapsid (core) Genotype-2b protein The E.coli derived recombinant protein contains the HCV core nucleocapsid immunodominant regions, amino acids 2-119. The protein is fused to GST	100	228-Eur	Biorb	recombinant
orb81429	Human Transferrin protein Recombinant Human Transferrin produced in Plant is non-glycosylated, polypeptide chain containing 679 amino acids and having a molecular mass of 76 kDa. The Recombinant Human	100 mg	154-Eur	Biorb	recombinant
orb81530	SARS Associated Spike Mosaic S(M) protein The E.coli derived 38 kDa recombinant mosaic protein contains the middle section of the Spike protein 408-470, 540-573 amino acids immunodominant regions. For	100	228-Eur	Biorb	recombinant
orb81567	Hepatitis Virus Nucleocapsid (core) (105-302) protein The E.coli derived recombinant protein from E1 region contains the HCV core nucleocapsid immunodominant regions, amino acids 105-302. The protein	100	228-Eur	Biorb	recombinant
orb81584	Hepatitis Virus NS3 Genotype-3 (1356-1459) protein The E.coli derived recombinant protein contains the HCV NS3 immunodominant regions, amino acids 1356-1459. The protein is fused to GST tag at N-termi	100	228-Eur	Biorb	recombinant
orb81576	Hepatitis Virus NS3 Genotype-1b (1192-1459) protein The E.coli derived recombinant protein contains the HCV NS3 immunodominant regions, amino acids 1192-1459. The protein is fused to GST tag at N-Term	100	228-Eur	Biorb	recombinant
orb80586	Mouse RELM alpha protein Mouse RELM alpha Recombinant produced in E.coli is monomeric, non-glycosylated, polypeptide chain containing 88 amino acids and having a molecular mass of 10 kDa. The Mouse RE	5	154-Eur	Biorb	recombinant
orb90150	Human HTRA2 protein HtrA2 Human Recombinant amino acids 134-458 His-Tag fusion protein produced in E.coli is a single, non-glycosylated polypeptide chain having a molecular mass of 32 kDa.The HtrA2 is	10	154-Eur	Biorb	recombinant
orb81589	Hepatitis Virus NS3 Genotype-6 (1356-1459) protein The E.coli derived recombinant protein contains the HCV NS3 immunodominant regions, amino acids 1356-1459. The protein is fused to GST tag at N-Termi	100	228-Eur	Biorb	recombinant
orb80481	Human Insulin protein Insulin Human Recombinant produced in E.coli is two chain, non-glycosylated polypeptide chain containing 51 amino acids and having a molecular mass of 5807 Dalton. Insulin is pur	25 mg	211-Eur	Biorb	recombinant
orb81582	Hepatitis Virus NS3 Genotype-2b (1356-1459) protein The E.coli derived recombinant protein contains the HCV NS3 immunodominant regions, amino acids 1356-1459. The protein is fused to GST tag at N-Term	100	228-Eur	Biorb	recombinant
orb81578	Hepatitis Virus NS3 Genotype-1b (1356-1459) protein The E.coli derived recombinant protein contains the HCV NS3 immunodominant regions, amino acids 1356-1459. The protein is fused to GST tag at N-Term	100	228-Eur	Biorb	recombinant
orb82833	Rhesus Macaque GMCSF protein Recombinant Rhesus Macaque GMCSF is a single non-glycosylated polypeptide chain containing 127 amino acids. GMCSF was initially characterized as a growth factor that can s	1 mg	3143-Eur	Biorb	recombinant
orb81574	Hepatitis Virus NS3 Genotype-1a (1192-1459) protein The E.coli derived recombinant protein contains the HCV NS3 immunodominant regions, amino acids 1192-1459. The protein is fused to GST tag at N-Term	100	228-Eur	Biorb	recombinant
orb81575	Hepatitis Virus NS3 Genotype-1a (1356-1459) protein The E.coli derived recombinant protein contains the HCV NS3 immunodominant regions, amino acids 1356-1459. The protein is fused to GST tag at N-Term	100	228-Eur	Biorb	recombinant
orb80539	Human PDGF AA Yeast protein PDGF-AA Human Recombinant produced in Yeast is homodimeric, glycosilated, polypeptide chain containing x 110 amino acids and having total molecular mass of 34 kDa. PDGF-AA	2	154-Eur	Biorb	recombinant
orb81605	Hepatitis Virus NS4 a+b, Biotin Labeled protein The E.coli derived 19 kDa recombinant protein Biotin labeled contains the HCV NS4 immunodominant regions, amino acids 1658-1863. The protein is fused wi	100	359-Eur	Biorb	recombinant
orb80248	Porcine Adiponectin glycosilated HEK protein The Acrp30 Porcine Recombinant contains total of 238 amino acids having a molecular mass of 26kDa. The Porcine Adiponectin is fused to 13 amino acid long N	2	154-Eur	Biorb	recombinant
orb81529	SARS Associated Spike Mosaic S(N) protein The E.coli derived 38 kDa mosaic protein contains the N-terminal section of the Spike protein 12-53, 90-115, 171-203 amino acids immunodominant regions. For r	100	228-Eur	Biorb	recombinant
orb81527	Malaria Protein HSP protein The E.coli derived recombinant Plasmodium falciparum contains the Plasmodium falciparum HSP70 protein epitopes 33-114 amino acids. For research use only.	100	228-Eur	Biorb	recombinant
orb80674	Rat Monocyte Chemotactic Protein-1 protein Monocyte Chemotactic Protein-1 Rat Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 125 amino acids and having a molecular ma	2	154-Eur	Biorb	recombinant
orb80326	Human Flt3-Ligand Sf9 protein Flt3-Ligand Human Recombinant produced in Sf9 insect cells is glycosylated, polypeptide chain containing 155 amino acids and having migrating on SDS-PAGE at 19kDa. Flt3-L	2	154-Eur	Biorb	recombinant
orb81478	Human Zinc-Alpha Glycoprotein ZA2G Human Recombinant produced in HEK cells is a single, glycosylated polypeptide chain containing total of 290 amino acids encoding (13-290). ZA2G Human Recombinant is	2	154-Eur	Biorb	recombinant
AS10 1601	Antibody: STN8 kinase | serine_threonine-protein kinase STN8, chloroplastic , Immunogen: KLH-conugated synthetic peptide (amino acids 425 - 438) specific for Arabidopsis thaliana STN8 serine_threonine	100 ug - for reconstitution please add100 ul of sterile water	361-Eur	Gentaur
orb90067	Human D-Amino Acid Oxidase protein DAAO Human Recombinant fused with 20 amino acid His tag at N-terminus produced in E.coli is a single, non-glycosylated, polypeptide chain containing 367 amino acids	2	154-Eur	Biorb	recombinant
orb81591	Hepatitis Virus NS3 (1450-1643) protein The E.coli derived 22kDa recombinant protein contains the HCV NS3 genotype 1b immunodominant regions, amino acids 1450-1643. The protein is fused with b-galacto	100	228-Eur	Biorb	recombinant
BS-010309-BK	External probe Probe type- thermocouple; Connector type- К; Cable- PTFE flat two core, good mechanical strength & flexibility, resistant to oils, acids, adverse agents, fluids; Cable length- 1 m; Oper		94-Eur	Biosan
EIAAB25509	Beta-microseminoprotein,Homo sapiens,Human,IGBF,Immunoglobulin-binding factor,MSMB,PN44,Prostate secreted seminal plasma protein,Prostate secretory protein of 94 amino acids,PRSP,PSP94,PSP-94,Seminal		1109-Eur	EIAab
BS-010309-BK	External probe- Probe type- thermocouple- Connector type- К- Cable- PTFE flat two core, good mechanical strength & flexibility,resistant to oils, acids, adverse agents, fluids- Cable length- 1 m- Oper	1	112-Eur	Biosan	rna
bs-2033P	Proteins: E.coli DH-5 Alpha(E.coli DH-5 Alpha Protein) Protein Length: 12-25 amino acids.	200ug lyophilized	206-Eur	Bios	Proteins
10-002-38010	DnaK (amino acids 385-546) - Heat shock protein 70; Heat shock 70 kDa protein; HSP70 N_A	1 mg	1103-Eur	GenWay	dna
10-002-38012	DnaK (amino acids 1-384) - Heat shock protein 70; Heat shock 70 kDa protein; HSP70 N_A	1 mg	1103-Eur	GenWay	dna
10-002-38014	DnaK (amino acids 508-638) - Heat shock protein 70; Heat shock 70 kDa protein; HSP70 N_A	1 mg	1103-Eur	GenWay	dna
10-002-38013	DnaK (amino acids 385-638) - Heat shock protein 70; Heat shock 70 kDa protein; HSP70 N_A	1 mg	1103-Eur	GenWay	dna
10-002-38011	DnaK (amino acids 1-638) - Heat shock protein 70; Heat shock 70 kDa protein; HSP70 N_A	1 mg	1103-Eur	GenWay	dna
bs-0887P	Peptides: Measles virus protein(Plant2 derived measles virus hemagglutinin protein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
bs-0888P	Peptides: Measles virus protein(Plant2 derived measles virus hemagglutinin protein) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
orb90010	Human Acyl-Coenzyme Dehydrogenase 8 protein Acyl-Coenzyme Dehydrogenase Human Recombinant produced in E.coli is non-glycosylated, polypeptide chain containing amino acids 1-415 and having total molecu	2	154-Eur	Biorb	recombinant
orb81128	E.coli Ferric Uptake Regulator protein Ferric Uptake Regulator Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 148 amino acids and having a molecular mass of	5	154-Eur	Biorb	recombinant
orb81573	Hepatitis Virus Nucleocapsid (core) 22kDa, Rhodamine Labeled protein The E.coli derived recombinant protein contains the HCV core nucleocapsid immunodominant regions, amino acids 2-192. The Rhodamine	100	359-Eur	Biorb	recombinant
orb80086	Mouse Keratinocyte Growth Factor protein Keratinocyte Growth Factor-1 Mouse Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 164 amino acids and having a mole	2	154-Eur	Biorb	recombinant
orb80357	Placental Ovine Growth Hormone protein Placental Growth Hormone Ovine Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 191 amino acids and having a molecular m	100	359-Eur	Biorb	recombinant
orb80720	Human Growth Hormone Releasing Peptide-2 protein Growth Hormone Releasing Peptide-2 Synthetic is a single, non-glycosylated polypeptide chain containing amino acids, having a molecular mass of 746.9 D	5 mg	154-Eur	Biorb	human
orb80182	Hepatitis Surface Antigen preS1 protein The E.coli derived Recombinant Hepatitis Surface Antigen preS1 is a single non-glycosylated polypeptide chain containing 119 amino acids and having molecular we	20	154-Eur	Biorb	recombinant
25-485	The kelch-repeat protein family is a recently found new kind of actin-binding protein. It is characterized by tandemly arranged motifs of about 50 amino acids. Most members of the kelch-repeat family	0.05 mg	632-Eur	Prosci	recombinant
orb80183	Hepatitis Surface Antigen preS2 protein The E.coli derivedRecombinant Hepatitis Surface Antigen preS2 is a single non-glycosylated polypeptide chain containing 55 amino acids having molecular weight o	20	154-Eur	Biorb	recombinant
orb81467	Human Von Hippel-Lindau protein Recombinant Human Von Hippel-Lindau Protein b-domain produced in E.coli is a single, non-glycosylated polypeptide chain containing 174 amino acids (1-154) having a mole	10	154-Eur	Biorb	recombinant
orb80505	Mouse Leptin Triple Antagonist protein Leptin Antagonist Triple Mutant Mouse Recombinant is a single non-glycosilated polypeptide chain containing 146 amino and additional Ala at N-terminus acids and	20	154-Eur	Biorb	recombinant
orb80970	Human Bcl2 Modifying Factor, Isoform 3 protein Bcl2 modifying factor Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 144 amino acids (1-129 a.a.) and h	5	154-Eur	Biorb	recombinant
orb80721	Growth Hormone Releasing Peptide-6 protein Growth Hormone Releasing Peptide-6 Synthetic is a single, non-glycosylated polypeptide chain containing amino acids, having a molecular mass of 873 Dalton an	5 mg	154-Eur	Biorb
orb80502	Human Leptin Triple Antagonist protein Leptin Antagonist Triple Mutant Human Recombinant is a single non-glycosilated polypeptide chain containing 146 amino and additional Ala at N-terminus acids and	20	154-Eur	Biorb	recombinant
28-194	The kelch-repeat protein family is a recently found new kind of actin-binding protein. It is characterized by tandemly arranged motifs of about 50 amino acids. Most members of the kelch-repeat family	0.1 mg	496-Eur	Prosci	recombinant
orb80085	Human Keratinocyte Growth Factor protein Keratinocyte Growth Factor-1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 164 amino acids and having a mole	2	154-Eur	Biorb	recombinant
orb80776	Human cyclin-C protein Cyclin Recombinant is expressed in E.coli as 35kDa tagged fusion protein corresponding to amino acids 120-303 of Cyclin of human origin. Cyclin is purified from bacterial lysate	2	154-Eur	Biorb	recombinant
orb90285	Human Tissue Plasminogen Activator protein Tissue Plasminogen Activator Human Recombinant produced in CHO cells is a single, glycosylated polypeptide chain containing 527 amino acids and having a mole	20	154-Eur	Biorb	recombinant
orb80509	Ovine Leptin Triple Antagonist protein Leptin Antagonist Triple Mutant Ovine Recombinant is a single non-glycosilated polypeptide chain containing 146 amino and additional Ala at N-terminus acids and	20	154-Eur	Biorb	recombinant
orb90297	Human Ubiquitin-Conjugating Enzyme E2L 3 protein Ubiquitin-Conjugating Enzyme E2L Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 154 amino acids having	10	154-Eur	Biorb	recombinant
orb90087	Human Neuronal Specific Enolase His tag protein Neuron Specific Enolase Human Recombinant is expressed in E.coli containing 433 amino acids 2-434 fused to an amino terminal hexahistidine tag.The NSE i	2	154-Eur	Biorb	recombinant
orb80484	Human Keratinocyte Growth Factor-2 protein Keratinocyte Growth Factor-2 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 170 amino acids and having a mol	5	154-Eur	Biorb	recombinant
orb90039	Yeast Adenosine 5'Triphosphate Sulfurylase protein Adenosine 5 Triphosphate Sulfurylase Yeast Recombinant produced in E.coli is non-glycosylated, polypeptide chain containg 511 amino acids and having	10 IU	170-Eur	Biorb	recombinant
orb90296	Human Ubiquitin-Conjugating Enzyme E2K protein Ubiquitin-Conjugating Enzyme E2K Human Recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 208 amino acids and having a mole	10	154-Eur	Biorb	recombinant
orb80516	Human Leukemia Inhibitory Factor protein Leukemia Inhibitory Factor (LIF) Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 180 amino acids and having a	2	154-Eur	Biorb	recombinant
orb80394	Human Interferon Regulatory Factor-2 protein Interferon Regulatory Factor-2 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 133 amino acids (1-113) wit	10	154-Eur	Biorb	recombinant
orb90004	Human Ubiquitin-Conjugating Enzyme E2I protein Ubiquitin-Conjugating Enzyme E2I Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 154 amino acids having a	10	154-Eur	Biorb	recombinant
orb81490	E.coli Dnak Lid Covering Substrate protein Recombinant DnaK Lid Covering Substrate domain produced in E.coli is a single, non-glycosylated polypeptide chain containing 132 amino acids and having a mol	20	154-Eur	Biorb	recombinant
orb80739	Human Leutenizing hormone Releasing Hormone (Gonadorelin) protein Lutenizing Hormone Releasing Hormone Human Synthetic is a single, non-glycosylated, polypeptide chain containing 10 amino acids and ha	10 mg	154-Eur	Biorb	human
orb80178	Human Superoxide Dismutase (homodimer) protein Recombinant Human Cu_Zn Superoxide Dismutase produced in E.coli is homodimer, non-glycosylated polypeptide chain containing 2x 154 amino acids and having	100	154-Eur	Biorb	recombinant
orb80393	Human Interferon Regulatory Factor-1 protein Interferon Regulatory Factor-1 Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 134 amino acids (1-114) wit	5	154-Eur	Biorb	recombinant
orb90210	Human Disulfide Isomerase protein Protein Disulfide Isomerase Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 508 amino acids and having a molecular ma	100	244-Eur	Biorb	recombinant
orb80557	Human Placenta Growth Factor-2 protein Placenta Growth Factor-2 Human Recombinant produced in insect cells is homodimer, glycosylated polypeptide chain containing x 152 amino acids and having total mo	2	154-Eur	Biorb	recombinant
orb81489	E.coli Dnak ATPase Binding Domain protein Recombinant DnaK Substrate Binding Domain produced in E.coli is a single, non-glycosylated polypeptide chain containing 384 amino acids and having a molecular	10	154-Eur	Biorb	recombinant
orb80556	Human Placenta Growth Factor-1 protein Placenta Growth Factor-1 Human Recombinant produced in insect cells is homodimer, glycosylated polypeptide chain containing x 131 amino acids and having total mo	2	154-Eur	Biorb	recombinant
orb82762	Human p16INK4a protein Recombinant Human Cyclin-Dependent Kinase Inhibitor 2A is a single non-glycosylated polypeptide chain containing 156 amino acids. Cyclin-dependent kinase inhibitors (CDKIs) are	1 mg	2144-Eur	Biorb	recombinant
orb80472	Mouse IL22, Pegylated protein Pegylated IL22 Mouse Recombinant produced in E.coli is a single, non-glycosylated homodimeric polypeptide chain containing 147 amino acids and an aditional Ala amino acid	2	154-Eur	Biorb	recombinant
orb82837	Rhesus macaque SAA1 protein Recombinant Rhesus Macaque Serum Amyloid A1 is a single non-glycosylated polypeptide chain containing 104 amino acids. Serum amyloid A proteins (SAA) represents a family of	1 mg	3143-Eur	Biorb	recombinant
26-237	Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as t	0.05 mg	632-Eur	Prosci	dna
25-347	Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as t	0.05 mg	632-Eur	Prosci	dna
orb90080	Disulfide Oxidoreductase protein Disulfide Oxidoreductase produced in E.coli is periplasmic protein isolated from E.coli, containing 208 amino acids having a molecular mass of 23,149 Dalton. The DsbA	10	154-Eur	Biorb	recombinant
30-292	Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as t	0.1 mg	496-Eur	Prosci	dna
31-325	The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO2. It contains multiple copies of three enzymatic components branched-chain	0.05 mg	632-Eur	Prosci	cat
orb80102	Human Stem Cell Factor protein Stem Cell Factor Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 165 amino acids and having a molecular mass of 18409 Dal	2	154-Eur	Biorb	recombinant
orb80482	Human Insulin Yeast protein Insulin Human Recombinant produced in Yeast is two chain, glycosylated polypeptide chain containing 51 amino acids and having a molecular mass of 5807 Dalton. Zinc content	2 mg	154-Eur	Biorb	recombinant
orb80601	Human Stem Cell Factor Sf9 protein Stem Cell Factor Human Recombinant produced in insect cells is a single, glycosylated polypeptide chain containing 165 amino acids and having a molecular mass of 184	2	154-Eur	Biorb	recombinant
orb80599	Mouse Stem Cell Factor protein Stem Cell Factor Mouse Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 165 amino acids and having a molecular mass of 18309 Dal	2	154-Eur	Biorb	recombinant
orb82836	Rhesus macaque S100B protein Recombinant Rhesus macaque S100 calcium binding protein B is a single, nonglycosylated polypeptide chain containing 92 amino acids. S100B is glial-specific and is expresse	1 mg	3143-Eur	Biorb	recombinant
orb90230	Human Placental Alkaline Phosphatase protein Placental Alkaline Phosphatase Human Recombinant encoding 154-287 amino acids expressed in E.coli, shows 41kDa band on SDS-PAGE (including GST tag).PLAP Hu	2	277-Eur	Biorb	recombinant
SMC-340D	GABA-A Receptor Beta1 Antibody Monoclonal, Clone number: S96-55 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 327-450 of mouse GABA-A-R-Beta1, accession number P50571	100ug	279-Eur	Stressmarq
SMC-411D	ADAM22 (cytoplasmic) Antibody Monoclonal, Clone number: S46-30 Host: Mouse, Isotype: IgG2B Immunogen: Fusion protein amino acids 757-857 (cytoplasmic region) of mouse ADAM22, accession number Q9R1V6	100ug	279-Eur	Stressmarq
SMC-339D	GABA-A Receptor Beta3 Antibody Monoclonal, Clone number: S87-25 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 370-433 of mouse GABA-A_r Beta3, accession number AAB60502.	100ug	279-Eur	Stressmarq
orb80254	Human AIF1 protein The AIF1 Human Recombinant contains total of 155 amino acids having a molecular mass of 17.7kDa. The Human AIF1 is fused to 9 amino acid long N-terminal His tag. For research use on	2	154-Eur	Biorb	recombinant
orb81354	Protein Export Protein SecB protein Recombinant E.coli SecB produced in E.coli is a single, non-glycosylated polypeptide chain containing 155 amino acids and having a molecular mass of 17.2 kDa. SecB	5	154-Eur	Biorb	recombinant
orb80325	Mouse Flt3-Ligand protein Flt3-Ligand Mouse Recombinant produced in E.coli is non-glycosylated, polypeptide chain containing 144 amino acids and having a molecular mass of 16431 Dalton. Flt3-Ligand is	2	154-Eur	Biorb	recombinant
orb80029	Human Flt3-Ligand protein Flt3-Ligand Human Recombinant produced in E.coli is non-glycosylated, polypeptide chain containing 155 amino acids and having a molecular mass of 17605 Dalton. Flt3-Ligand is	2	154-Eur	Biorb	recombinant
orb81109	Human Factor VIIa protein Factor VIIa Human Recombinant produced in BHK is glycosylated polypeptide two-chain dimer consisting of 406 amino acids with molecular weight of 50kD.The Factor-VIIa is purif	10	228-Eur	Biorb	recombinant
orb81775	Rubella Virus Capsid C protein The E.coli derived recombinant protein contains the Rubella Virus Capsid regions, 1-123 amino acids. For research use only.	100	228-Eur	Biorb	recombinant
8001-29-4	Cottonseed oil fatty acids Cottonseed oil fatty aci	1g	----Eur	chemotra
orb81117	Human Ferritin Light Chain protein Ferritin Human Recombinant Light Chain produced in E.coli is a single, non-glycosylated polypeptide chain containing 175 amino acids and having a molecular mass of 2	5	154-Eur	Biorb	recombinant
03-003-5	Fibroblast Growth Factor 1 (FGF_1), human, active Full length recombinant mature FGF_1 (15.8 kDa, 140 amino acids) expressed in E. coli.FGF_1 (acidic FGF) is a member of the fibroblast growth factor (	5 x 50 ug	808-Eur	BBridge	recombinant
03-003	Fibroblast Growth Factor 1 (FGF_1), human, active Full length recombinant mature FGF_1 (15.8 kDa, 140 amino acids) expressed in E. coli.FGF_1 (acidic FGF) is a member of the fibroblast growth factor (	50 ug	253-Eur	BBridge	recombinant
orb80921	Human Assembly Protein Complex 2 protein Assembly Protein Complex Human Recombinant produced in E.coli is non-glycosylated, polypeptide chain containing amino acids (1-435) and having total molecular	2	154-Eur	Biorb	recombinant
orb80735	Human Inhibin-Alpha Chain protein Inhibin-Alpha chain Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 134 amino acids fragment (233-366) and having an	2	154-Eur	Biorb	recombinant
orb81200	Listeriolysin-O PEST-free protein Recombinant Listeriolysin lacking both the signal secretion sequence and the PEST- like sequence. LLO-PEST minus is composed of 471 amino acids, starting from amino a	10	244-Eur	Biorb	recombinant
orb81570	Hepatitis Virus Nucleocapsid (core) 22kDa protein The E.coli derived recombinant protein contains the HCV core nucleocapsid genotype 1b, immunodominant regions, amino acids 2-192, 22kDa.The protein is	100	228-Eur	Biorb	recombinant
orb80922	Human Assembly Protein Complex 3 protein Assembly Protein Complex Human Recombinant produced in E.coli is non-glycosylated, polypeptide chain containing amino acids (1-193) and having total molecular	2	154-Eur	Biorb	recombinant
orb81665	Cytomegalo Virus Pp65(UL83) protein The E.coli derived 52.2 kDa recombinant protein contains the CMV Pp65 (UL83) immunodominant regions, 297-510 amino acids. Recombinant CMV-Pp65 is fused to 26 kDa GS	100	228-Eur	Biorb	recombinant
orb81664	Cytomegalo Virus Pp52 (UL44) protein The E.coli derived 51 kDa recombinant protein contains the CMV Pp52 (UL44) immunodominant regions, 202-434 amino acids. Recombinant CMV-Pp52 is fused to 26 kDa GST	100	228-Eur	Biorb	recombinant
orb80852	Human Protein Kinase alpha protein Protein Kinase alpha Human Recombinant produced in Sf9 is glycosylated, polypeptide chain containing amino acids 2-672 and having a molecular mass of 80 KD. This pro	2	154-Eur	Biorb	recombinant
orb80673	Mouse Monocyte Chemotactic Protein-1 protein Monocyte Chemotactic Protein-1 Mouse Recombinant produced in E.coli is a single,non-glycosylated, polypeptide chain containing 125 amino acids and having a	2	154-Eur	Biorb	recombinant
orb80794	Human ELK-1 protein ELK-1 (amino acids 307-428) Human Recombinant is produced in E.coli as maltose binding protein (MBP) fusion protein with an amino-terminal polyhistidine tag and c-terminal myc tag	2	154-Eur	Biorb	recombinant
orb84841	Beta actin protein Beta actin protein recombinant produced in E.coli is non-glycosylated, Polypeptide chain containing 383 amino acids and having a molecular mass of 42.8 kDa. The beta actin protein i	0.5 mg	686-Eur	Biorb	recombinant
orb80754	Salmon Calcitonin Acetate protein Calcitonin Acetate (Salmon) is synthetic polypeptide of 32 amino acids in the same linear sequencethat is found in clacitonin of salmon origin. Calcitonin Acetate (Sa	1 mg	195-Eur	Biorb
SCH-PHP210	RECOMBINANT HUMAN DEFENSIN BETA 1 (36 AMINO ACIDS), Product Type Recombinant Protein, Specificity DEFENSIN BETA 1, Target Species Human, Host N_A, Format Rec. Protein, Isotypes , Applications F	20 µg	290-Eur	Serotech	recombinant
PHP210	RECOMBINANT HUMAN DEFENSIN BETA 1 (36 AMINO ACIDS), Product Type Recombinant Protein, Specificity DEFENSIN BETA 1, Target Species Human, Host N_A, Format Rec. Protein, Isotypes , Applications F	20 µg	290-Eur	AbD	recombinant
orb81522	Phospholipase A2 P00630 Bee Venom protein The E.coli derived recombinant protein contains phospholipase P00630 bee venom protein epitopes, 26-162 amino acids. For research use only.	100	228-Eur	Biorb	recombinant
orb80349	Human Pituitary Growth Hormone 20kDa protein Growth Hormone 20KDa Pituitary Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 177 amino acids and having	100	359-Eur	Biorb	recombinant
orb80350	Human Placental Growth Hormone 20kDa protein Growth Hormone Placental 20kDa Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 177 amino acids and having	100	359-Eur	Biorb	recombinant
orb81571	Hepatitis Virus Nucleocapsid (core) 22kDa, Biotin protein The E.coli derived recombinant protein contains the HCV core nucleocapsid immunodominant regions, amino acids 2-192, 22kDa.The Biotin labeled	100	359-Eur	Biorb	recombinant
orb81768	Measles Virus Large Polymerase (2059-2183) protein The E.coli derived recombinant protein contains the large polymerase immunodominant regions, 2059-2183 amino acids. For research use only.	100	228-Eur	Biorb	recombinant
orb80352	Ovine Growth Hormone Binding protein Growth Hormone Binding Protein Ovine Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 237 amino acids and having a molecu	100	359-Eur	Biorb	recombinant
orb80354	Rabbit Growth Hormone Binding protein Growth Hormone Binding Protein Rabbit Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 248 amino acids and having a mole	100	359-Eur	Biorb	recombinant
orb80351	Human Growth Hormone Binding protein Growth Hormone Binding Protein Human Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 237 amino acids and having a molecu	100	359-Eur	Biorb	recombinant
orb80353	Bovine Growth Hormone Binding protein Growth Hormone Binding Protein Bovine Recombinant produced in E.coli is a single, non-glycosylated, polypeptide chain containing 237 amino acids and having a mole	100	359-Eur	Biorb	recombinant
orb81487	E.coli Dnak Substrate Binding Domain protein Recombinant DnaK Substrate Binding domain produced in E.coli is a single, non-glycosylated polypeptide chain containing 132 amino acids and having a molecu	20	154-Eur	Biorb	recombinant
31106	TAF1L (1517-1649), GST-tag, Human Recombinant Protein,Human TAF1 RNA polymerase II, TAT box binding protein (TBP)-associated factor, also known as TAF1L, amino acids 1517 – 1649 (GenBank Accession No.	100	429-Eur	BPS Bioscience
orb80717	Human Growth Hormone Releasing Hormone protein Growth Hormone Releasing Hormone Human Synthetic is a single, non-glycosylated, polypeptide chain containing 29 amino acids and having a molecular mass o	250	154-Eur	Biorb	human
orb81565	Hepatitis Virus Nucleocapsid (core), Biotin Labeled protein The E.coli derived recombinant Biotin Labeled protein contains the HCV core nucleocapsid immunodominant regions, amino acids 2-192, having a	100	359-Eur	Biorb	recombinant
31105	TAF1L (1398-1516), GST-tag, Human Recombinant Protein,Human TAF1 RNA polymerase II, TAT box binding protein (TBP)-associated factor, also known as TAF1L, amino acids 1398 – 1516 (GenBank Accession No.	100	429-Eur	BPS Bioscience
orb81337	Human S100 Calcium Binding Protein A7A protein The S100A7A Human Recombinant is manufactured with N-terminal fusion of amino acids His Tag. The S100A7A His -Tagged Fusion Protein is 12.3kDa protein co	2	154-Eur	Biorb	recombinant
orb90017	Human Adenosine Deaminase tRNA-Specific 1 protein Adenosine Deaminase tRNA-Specific Human Recombinant produced in E.coli is non-glycosylated, polypeptide chain containing amino acids 1-502 and having	2	154-Eur	Biorb	recombinant
orb81757	Tick-Borne Encephalitis Virus gE protein The E.coli derived recombinant protein contains the Tick-borne Encephalitis Virus glycoprotein regions, 95-229 amino acids. For research use only.	100	228-Eur	Biorb	recombinant
31107	TAF1L (1398-1649), BD1 & BD2, GST-tag, Human Recombinant Protein,Human TAF1 RNA polymerase II, TAT box binding protein (TBP)-associated factor, also known as TAF1L, amino acids 1398 – 1649, tandem Br	100	429-Eur	BPS Bioscience
orb82830	Rhesus macaque Flt3 Ligand protein Recombinant Rhesus Macaque Flt3 Ligand is a single, non-glycosylated polypeptide chain containing 159 amino acids. Flt3 ligand is a recently identified hematopoietic	1 mg	3143-Eur	Biorb	recombinant
orb81449	Human U1-snRNP 68kDa protein Recombinant Human U1-snRNP 68kDa cDNA codes for the 70kDa isoform of the human U1-snRNP 68 protein (lacking 66 internal amino acids outside the known epitope-containing ar	5	154-Eur	Biorb	recombinant
orb81761	Tick-Borne Encephalitis Virus gE C-end (296-414) protein The E.coli derived recombinant protein contains the Tick-borne Encephalitis Virus C-end regions of glycoprotein E, 296-414 amino acids. For res	100	228-Eur	Biorb	elisa
27-960	The protein encoded by FABP7 is a brain fatty acid binding protein. Fatty acid binding proteins (FABPs) are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids a	0.1 mg	496-Eur	Prosci	Proteins
orb90049	Human Carbonic Anhydrase 2 protein Carbonic anhydrase Human Recombinant protein produced in E.coli containing 260 amino acids (1-260) and having a molecular mass of 29.2 kDa. The Carbonic anhydrase is	5	154-Eur	Biorb	recombinant
orb90048	E.coli Carbonic Anhydrase 2 protein Carbonic anhydrase II is an E.coli Recombinant protein produced in E.coli containing 240 amino acids (1-220) and having a molecular mass of 27 kDa. Carbonic anhydra	5	154-Eur	Biorb	recombinant
orb80862	Human Protein Phosphatase 1A Alpha Isoform protein Protein Phosphatase 1A Alpha Isoform Human Recombinant produced is a single, non-glycosylated polypeptide chain containing 382 amino acids and having	10	154-Eur	Biorb	recombinant
orb82642	Fatty-acid binding protein 5 His tag protein The fatty-acid-binding proteins (FABPs) are a family of carrier proteins for fatty acids and other lipophilic substances such as eicosanoids and retinoids.	100	277-Eur	Biorb	Proteins
orb90005	Human Ubiquitin Conjugating Enzyme E2M protein Ubiquitin Conjugating Enzyme E2M Human Recombinant produced in E.coli is 25 kDa protein containing 216 amino acids.The UBE2M protein contains 6xHis tag a	10	154-Eur	Biorb	recombinant
orb90293	Human Ubiquitin Conjugating Enzyme E2B protein Ubiquitin Conjugating Enzyme E2B Human Recombinant produced in E.coli is 19 kDa protein containing 166 amino acids.The UE2B protein contains 6xHis tag an	2	154-Eur	Biorb	recombinant
orb90003	Human Ubiquitin Conjugating Enzyme E2C protein Ubiquitin Conjugating enzyme E2C Human Recombinant produced in E.coli is 21.1 kDa protein containing 191 amino acids.The UBE2C protein contains 6xHis tag	10	154-Eur	Biorb	recombinant
orb90298	Human Ubiquitin-Conjugating Enzyme E2L 3 His tag protein Ubiquitin-Conjugating Enzyme E2L Human Recombinant produced in E.coli is an 18.9 kDa protein containing 162 amino acids.The UBE2L3 protein cont	10	154-Eur	Biorb	recombinant
orb81760	Tick-Borne Encephalitis Virus gE middle (50-250) protein The E.coli derived recombinant protein contains the Tick-borne Encephalitis Virus glycoprotein middle regions, 50-250 amino acids. For research	100	228-Eur	Biorb	recombinant
25-086	Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. MARS belongs to the class I family of tRNA synthetases.Aminoacyl-tRNA synthetases are a class of enz	0.05 mg	632-Eur	Prosci	rna
orb90295	Human Ubiquitin-Conjugating Enzyme E2I His tag protein Ubiquitin-Conjugating Enzyme E2I Human Recombinant produced in E.coli is 19.5 kDa protein containing 171 amino acids.The UBE2I protein contains 6	10	154-Eur	Biorb	recombinant
EIAAB12848	3-keto acyl-CoA synthase Elovl6,Elongation of very long chain fatty acids protein 6,Elovl6,Face,Fatty acyl-CoA elongase,Lce,Long chain fatty acid elongase,Masr,Mouse,Mus musculus,Myelin-associated SUR		1164-Eur	EIAab
orb81224	Human Myosin Light Chain 1 protein Recombinant Human Ventricular Myosin Light Chain-1 (MYL1) protein has molecular mass of 25 kDa and is fused to amino acids at N-terminus. The MYL1 protein was affini	2	154-Eur	Biorb	recombinant
bs-0429P	Peptides: WNK4(Ser_Thr-protein kinase WNK4; protein kinase with no lysine 4; protein kinase, lysine –dficient 4) Protein Length:12-25 amino acids.	200ug lyophilized	206-Eur	Bios
orb90294	Human Ubiquitin Conjugating Enzyme E2D3 protein Ubiquitin Conjugating Enzyme E2D3 Human Recombinant produced in E.coli is an 18 kDa protein containing 155 amino acids.The UBE2D3 protein contains 6xHis	10	154-Eur	Biorb	recombinant
EIAAB12849	3-keto acyl-CoA synthase ELOVL6,Elongation of very long chain fatty acids protein 6,ELOVL6,FACE,Fatty acid elongase 2,Fatty acyl-CoA elongase,hELO2,Homo sapiens,Human,LCE,Long-chain fatty-acyl elongas		1109-Eur	EIAab
26-337	PECI is an auxiliary enzyme that catalyzes an isomerization step required for the beta-oxidation of unsaturated fatty acids.PECI is an auxiliary enzyme that catalyzes an isomerization step required fo	0.05 mg	632-Eur	Prosci	cat
EIAAB12846	3-keto acyl-CoA synthase Elovl6,Elongation of very long chain fatty acids protein 6,Elovl6,Face,Fatty acid elongase 2,Fatty acyl-CoA elongase,Lce,Long-chain fatty-acyl elongase,Rat,Rattus norvegicus,r		1191-Eur	EIAab
Catalog-Num	Product Name	Quantity	Price	Supplier